Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A3A097

Protein Details
Accession A0A3A3A097   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-48TASQREAKRRKDRVTKRLRVQKQKESIHydrophilic
NLS Segment(s)
PositionSequence
27-40EAKRRKDRVTKRLR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MDALSSSRPVPTKPWSSGRVLTASQREAKRRKDRVTKRLRVQKQKESIQELRNQISALQNLTQKNLGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.48
4 0.5
5 0.47
6 0.43
7 0.37
8 0.36
9 0.33
10 0.32
11 0.34
12 0.34
13 0.4
14 0.43
15 0.52
16 0.57
17 0.61
18 0.67
19 0.71
20 0.77
21 0.8
22 0.84
23 0.83
24 0.82
25 0.84
26 0.85
27 0.85
28 0.83
29 0.82
30 0.8
31 0.78
32 0.74
33 0.72
34 0.69
35 0.64
36 0.63
37 0.58
38 0.51
39 0.45
40 0.4
41 0.33
42 0.31
43 0.28
44 0.24
45 0.23
46 0.26
47 0.26
48 0.28