Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZPS1

Protein Details
Accession A0A3A2ZPS1   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-41LLWKTPWRISQPQKARQRKRLRSVDRVVDTHydrophilic
74-100KYTIFDKKERKYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
80-94KKERKYRKGIHKLPK
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSSLLGGLLWKTPWRISQPQKARQRKRLRSVDRVVDTVSAALQRNGYEAKAVQRWYAEMPREEEMLPKDKYTIFDKKERKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.2
5 0.25
6 0.34
7 0.41
8 0.5
9 0.59
10 0.66
11 0.75
12 0.82
13 0.84
14 0.85
15 0.88
16 0.88
17 0.88
18 0.89
19 0.87
20 0.85
21 0.83
22 0.81
23 0.72
24 0.63
25 0.54
26 0.43
27 0.35
28 0.25
29 0.19
30 0.12
31 0.1
32 0.09
33 0.09
34 0.08
35 0.09
36 0.1
37 0.09
38 0.08
39 0.08
40 0.11
41 0.13
42 0.14
43 0.13
44 0.13
45 0.14
46 0.16
47 0.19
48 0.19
49 0.18
50 0.2
51 0.2
52 0.22
53 0.21
54 0.21
55 0.19
56 0.23
57 0.22
58 0.19
59 0.19
60 0.19
61 0.22
62 0.26
63 0.32
64 0.3
65 0.39
66 0.47
67 0.54
68 0.63
69 0.7
70 0.69
71 0.71
72 0.76
73 0.78
74 0.81
75 0.83
76 0.83
77 0.84
78 0.89
79 0.88
80 0.88
81 0.83
82 0.8
83 0.8
84 0.8
85 0.8
86 0.77
87 0.79