Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3A2Z9Z9

Protein Details
Accession A0A3A2Z9Z9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
47-70DMWDGRKPKKTKVRWTKKKDSMLLHydrophilic
NLS Segment(s)
PositionSequence
51-65GRKPKKTKVRWTKKK
Subcellular Location(s) nucl 17, cyto_nucl 11.5, cyto 4, pero 3
Family & Domain DBs
Amino Acid Sequences MAEPKPPVTESKPATPAQRTEGLKEAQLQIAKTLTEMKAWIRHQPRDMWDGRKPKKTKVRWTKKKDSMLLLAVAKTKDEDNGPDWENLSDMVGRDRYPPDELEDRFYYMAYKSAMGRLSQTAAALRAEEATREEETTAEEEPEKIVWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.48
4 0.45
5 0.48
6 0.42
7 0.4
8 0.43
9 0.39
10 0.35
11 0.36
12 0.33
13 0.28
14 0.29
15 0.25
16 0.21
17 0.21
18 0.19
19 0.16
20 0.18
21 0.15
22 0.14
23 0.15
24 0.16
25 0.22
26 0.23
27 0.31
28 0.34
29 0.38
30 0.4
31 0.44
32 0.45
33 0.44
34 0.47
35 0.45
36 0.45
37 0.52
38 0.55
39 0.6
40 0.58
41 0.61
42 0.67
43 0.7
44 0.73
45 0.74
46 0.79
47 0.8
48 0.88
49 0.89
50 0.88
51 0.87
52 0.8
53 0.72
54 0.64
55 0.54
56 0.47
57 0.37
58 0.29
59 0.23
60 0.19
61 0.15
62 0.12
63 0.1
64 0.09
65 0.09
66 0.1
67 0.1
68 0.14
69 0.15
70 0.15
71 0.16
72 0.15
73 0.14
74 0.12
75 0.11
76 0.08
77 0.06
78 0.08
79 0.08
80 0.09
81 0.11
82 0.13
83 0.14
84 0.15
85 0.16
86 0.19
87 0.24
88 0.24
89 0.28
90 0.28
91 0.28
92 0.26
93 0.25
94 0.22
95 0.16
96 0.18
97 0.13
98 0.13
99 0.12
100 0.15
101 0.17
102 0.16
103 0.18
104 0.16
105 0.18
106 0.17
107 0.17
108 0.14
109 0.14
110 0.14
111 0.13
112 0.11
113 0.11
114 0.11
115 0.11
116 0.12
117 0.14
118 0.15
119 0.15
120 0.15
121 0.13
122 0.15
123 0.17
124 0.16
125 0.14
126 0.14
127 0.14
128 0.14