Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3A2ZS34

Protein Details
Accession A0A3A2ZS34    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
107-140EKSIEKQKSEKKRLEEGKKKKQNKKSRRVRESKRBasic
NLS Segment(s)
PositionSequence
112-140KQKSEKKRLEEGKKKKQNKKSRRVRESKR
Subcellular Location(s) nucl 14, mito_nucl 13.5, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MFKPSPHMMARLRLTTKQVGRGYYKGNRTGSMGFFAKPGSYVIDWKKVRTYVAPENLDNFPLTPFVTKAMPPTKSLYYNGRSRPQFQGNNYLDLWATANTEEVNAIEKSIEKQKSEKKRLEEGKKKKQNKKSRRVRESKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.5
4 0.5
5 0.49
6 0.46
7 0.47
8 0.48
9 0.5
10 0.49
11 0.52
12 0.5
13 0.48
14 0.45
15 0.43
16 0.42
17 0.36
18 0.34
19 0.29
20 0.22
21 0.21
22 0.2
23 0.17
24 0.14
25 0.13
26 0.11
27 0.11
28 0.16
29 0.18
30 0.28
31 0.28
32 0.29
33 0.32
34 0.3
35 0.3
36 0.28
37 0.31
38 0.3
39 0.37
40 0.39
41 0.36
42 0.38
43 0.37
44 0.34
45 0.28
46 0.2
47 0.12
48 0.1
49 0.1
50 0.07
51 0.07
52 0.08
53 0.09
54 0.08
55 0.13
56 0.17
57 0.18
58 0.19
59 0.22
60 0.23
61 0.24
62 0.27
63 0.28
64 0.27
65 0.33
66 0.36
67 0.4
68 0.4
69 0.41
70 0.45
71 0.48
72 0.48
73 0.44
74 0.5
75 0.43
76 0.45
77 0.41
78 0.36
79 0.27
80 0.23
81 0.21
82 0.11
83 0.1
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.09
91 0.08
92 0.08
93 0.08
94 0.09
95 0.12
96 0.2
97 0.23
98 0.22
99 0.3
100 0.39
101 0.5
102 0.59
103 0.63
104 0.61
105 0.68
106 0.77
107 0.81
108 0.82
109 0.82
110 0.84
111 0.87
112 0.92
113 0.91
114 0.92
115 0.92
116 0.92
117 0.93
118 0.92
119 0.93
120 0.94