Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NX89

Protein Details
Accession B8NX89    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-87YTVVSQASRRRRRRPPLKSVLAGHydrophilic
NLS Segment(s)
PositionSequence
73-81RRRRRRPPL
Subcellular Location(s) plas 7, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYLMETIRDSAFGKLVRFFSGYRLLLYPEEIHDVTWRNYLGRPEASQEESMTPDSEEFYELHALYTVVSQASRRRRRRPPLKSVLAGPWRGTQDGSSEVIGWSDAGDSENPQNWSIRKKVLVTLLICLLTFFIYIGSAIYTPGIPGVAQQFGVSKEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.25
5 0.24
6 0.24
7 0.3
8 0.28
9 0.26
10 0.26
11 0.26
12 0.24
13 0.26
14 0.23
15 0.16
16 0.2
17 0.18
18 0.17
19 0.18
20 0.2
21 0.2
22 0.21
23 0.2
24 0.17
25 0.19
26 0.22
27 0.23
28 0.23
29 0.22
30 0.23
31 0.26
32 0.27
33 0.26
34 0.24
35 0.21
36 0.2
37 0.2
38 0.17
39 0.13
40 0.11
41 0.11
42 0.1
43 0.1
44 0.08
45 0.09
46 0.1
47 0.1
48 0.1
49 0.09
50 0.09
51 0.08
52 0.08
53 0.07
54 0.05
55 0.05
56 0.06
57 0.12
58 0.23
59 0.33
60 0.4
61 0.49
62 0.58
63 0.69
64 0.79
65 0.82
66 0.83
67 0.82
68 0.81
69 0.73
70 0.66
71 0.62
72 0.56
73 0.48
74 0.38
75 0.32
76 0.27
77 0.25
78 0.23
79 0.16
80 0.13
81 0.15
82 0.15
83 0.11
84 0.11
85 0.1
86 0.1
87 0.1
88 0.08
89 0.05
90 0.04
91 0.04
92 0.05
93 0.05
94 0.07
95 0.09
96 0.13
97 0.14
98 0.15
99 0.17
100 0.19
101 0.23
102 0.25
103 0.27
104 0.27
105 0.27
106 0.31
107 0.34
108 0.37
109 0.34
110 0.33
111 0.3
112 0.27
113 0.25
114 0.21
115 0.16
116 0.1
117 0.09
118 0.07
119 0.05
120 0.05
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.07
127 0.06
128 0.06
129 0.07
130 0.07
131 0.05
132 0.07
133 0.1
134 0.11
135 0.11
136 0.12
137 0.13