Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8SWE9

Protein Details
Accession A0A3D8SWE9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-22ASTKSDLSKRRRFQPPITTFFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013900  RNR_inhibitor  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08591  RNR_inhib  
Amino Acid Sequences MASTKSDLSKRRRFQPPITTFFTTSSDPNSSSSPSHLSYNHYSAVTNSPTPVVPAKVQASLLSVGMRVRKSIADGYKTHQGKADKYTTFSCDNANNDTPKPTITTATIYNATIYNSDAPVRSELAPFCGMSKSDEYTCIAPQPLPTAHHYHHIITTEEDDAFSIPPSSQESVDSTLEPTAHKKRTRHDFDFDPYDDEDDEMDPVHPHSGTNISGRTILSPKASYQCRTAQIYKAGQTMDLDDFEEPSFLRRRDEVEGEIQMGGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.81
4 0.78
5 0.77
6 0.71
7 0.62
8 0.57
9 0.51
10 0.42
11 0.34
12 0.32
13 0.28
14 0.25
15 0.25
16 0.25
17 0.24
18 0.24
19 0.25
20 0.24
21 0.23
22 0.26
23 0.25
24 0.3
25 0.32
26 0.35
27 0.34
28 0.3
29 0.29
30 0.27
31 0.31
32 0.28
33 0.23
34 0.2
35 0.19
36 0.19
37 0.21
38 0.21
39 0.18
40 0.16
41 0.2
42 0.21
43 0.21
44 0.21
45 0.2
46 0.19
47 0.17
48 0.17
49 0.12
50 0.11
51 0.11
52 0.15
53 0.15
54 0.13
55 0.14
56 0.13
57 0.16
58 0.22
59 0.25
60 0.26
61 0.27
62 0.31
63 0.38
64 0.39
65 0.37
66 0.35
67 0.33
68 0.31
69 0.36
70 0.39
71 0.31
72 0.34
73 0.35
74 0.34
75 0.34
76 0.31
77 0.27
78 0.23
79 0.25
80 0.27
81 0.28
82 0.27
83 0.25
84 0.27
85 0.25
86 0.21
87 0.21
88 0.17
89 0.15
90 0.14
91 0.16
92 0.15
93 0.17
94 0.17
95 0.15
96 0.15
97 0.14
98 0.13
99 0.11
100 0.11
101 0.09
102 0.08
103 0.09
104 0.08
105 0.09
106 0.1
107 0.11
108 0.11
109 0.11
110 0.11
111 0.13
112 0.13
113 0.12
114 0.12
115 0.11
116 0.1
117 0.11
118 0.12
119 0.11
120 0.11
121 0.12
122 0.12
123 0.13
124 0.13
125 0.12
126 0.11
127 0.1
128 0.1
129 0.12
130 0.12
131 0.13
132 0.15
133 0.18
134 0.19
135 0.23
136 0.25
137 0.23
138 0.23
139 0.22
140 0.21
141 0.17
142 0.18
143 0.14
144 0.12
145 0.11
146 0.1
147 0.09
148 0.08
149 0.07
150 0.06
151 0.05
152 0.06
153 0.09
154 0.1
155 0.1
156 0.11
157 0.13
158 0.16
159 0.17
160 0.16
161 0.14
162 0.14
163 0.14
164 0.14
165 0.17
166 0.22
167 0.28
168 0.34
169 0.37
170 0.45
171 0.55
172 0.64
173 0.64
174 0.62
175 0.6
176 0.6
177 0.63
178 0.56
179 0.48
180 0.39
181 0.34
182 0.29
183 0.23
184 0.18
185 0.12
186 0.11
187 0.08
188 0.08
189 0.08
190 0.08
191 0.09
192 0.08
193 0.08
194 0.1
195 0.12
196 0.13
197 0.16
198 0.17
199 0.17
200 0.18
201 0.18
202 0.2
203 0.19
204 0.19
205 0.2
206 0.2
207 0.22
208 0.28
209 0.33
210 0.32
211 0.34
212 0.39
213 0.41
214 0.46
215 0.47
216 0.45
217 0.48
218 0.5
219 0.49
220 0.46
221 0.4
222 0.35
223 0.32
224 0.29
225 0.24
226 0.19
227 0.17
228 0.14
229 0.15
230 0.15
231 0.14
232 0.11
233 0.14
234 0.2
235 0.2
236 0.24
237 0.24
238 0.28
239 0.34
240 0.38
241 0.38
242 0.37
243 0.38
244 0.36