Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8QBY0

Protein Details
Accession A0A3D8QBY0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-113NAGSRSQRSGRIQKRQRKNRSSIVFKPHPHydrophilic
NLS Segment(s)
PositionSequence
92-123RSGRIQKRQRKNRSSIVFKPHPSKTNKAPRKK
Subcellular Location(s) mito 15, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSVRASVQKRNKAKLRSTVFGPAVDARTERLSAKLQELASQPKPSATEKSKKDTGATDLDTQAGDKTTPESSEAMDIDSSGGNAGSRSQRSGRIQKRQRKNRSSIVFKPHPSKTNKAPRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.78
4 0.75
5 0.69
6 0.65
7 0.63
8 0.56
9 0.48
10 0.43
11 0.35
12 0.3
13 0.26
14 0.23
15 0.17
16 0.17
17 0.18
18 0.16
19 0.16
20 0.18
21 0.19
22 0.21
23 0.23
24 0.22
25 0.24
26 0.26
27 0.3
28 0.29
29 0.29
30 0.27
31 0.24
32 0.26
33 0.24
34 0.29
35 0.28
36 0.34
37 0.36
38 0.43
39 0.45
40 0.44
41 0.43
42 0.37
43 0.35
44 0.3
45 0.29
46 0.24
47 0.2
48 0.2
49 0.18
50 0.16
51 0.13
52 0.09
53 0.07
54 0.05
55 0.07
56 0.07
57 0.07
58 0.09
59 0.09
60 0.09
61 0.11
62 0.11
63 0.1
64 0.09
65 0.08
66 0.08
67 0.07
68 0.07
69 0.05
70 0.05
71 0.04
72 0.04
73 0.07
74 0.11
75 0.12
76 0.15
77 0.17
78 0.24
79 0.32
80 0.42
81 0.49
82 0.56
83 0.65
84 0.72
85 0.82
86 0.86
87 0.89
88 0.88
89 0.87
90 0.86
91 0.86
92 0.85
93 0.82
94 0.82
95 0.79
96 0.75
97 0.75
98 0.72
99 0.7
100 0.67
101 0.67
102 0.67
103 0.7