Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8Q7Z4

Protein Details
Accession A0A3D8Q7Z4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
152-182TTGNLDKEERKRLKKERRKAEKKAKLKDSDEBasic
NLS Segment(s)
PositionSequence
160-178ERKRLKKERRKAEKKAKLK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.833, mito_nucl 10.666, cyto 7
Family & Domain DBs
Amino Acid Sequences MATQDPTPLPPTTVLSSKPISQSIAHDFLAAYLDRATTDPALQPNAGISEHGPVSRTTAAAPNIILHNLKRVQAGLAGEVLGRDLAIAEMKEGAQLAQAQNAKENAHGTWEDKAHFEQDQEGLQVHDANVRDEPEAMEVDNVDQIEGEAAATTGNLDKEERKRLKKERRKAEKKAKLKDSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.29
4 0.31
5 0.32
6 0.3
7 0.28
8 0.26
9 0.29
10 0.31
11 0.33
12 0.29
13 0.26
14 0.24
15 0.22
16 0.23
17 0.18
18 0.12
19 0.08
20 0.08
21 0.09
22 0.09
23 0.11
24 0.09
25 0.11
26 0.13
27 0.14
28 0.17
29 0.16
30 0.15
31 0.14
32 0.15
33 0.13
34 0.11
35 0.09
36 0.1
37 0.11
38 0.11
39 0.11
40 0.1
41 0.13
42 0.14
43 0.13
44 0.12
45 0.15
46 0.16
47 0.16
48 0.16
49 0.14
50 0.14
51 0.15
52 0.15
53 0.1
54 0.15
55 0.16
56 0.17
57 0.16
58 0.15
59 0.14
60 0.16
61 0.16
62 0.11
63 0.09
64 0.08
65 0.08
66 0.07
67 0.07
68 0.04
69 0.03
70 0.03
71 0.02
72 0.02
73 0.03
74 0.03
75 0.03
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.06
83 0.06
84 0.1
85 0.12
86 0.12
87 0.14
88 0.15
89 0.15
90 0.14
91 0.15
92 0.1
93 0.11
94 0.12
95 0.12
96 0.13
97 0.14
98 0.14
99 0.15
100 0.15
101 0.15
102 0.15
103 0.14
104 0.12
105 0.12
106 0.12
107 0.12
108 0.11
109 0.1
110 0.09
111 0.1
112 0.08
113 0.1
114 0.1
115 0.11
116 0.12
117 0.13
118 0.13
119 0.12
120 0.13
121 0.11
122 0.11
123 0.1
124 0.09
125 0.08
126 0.08
127 0.09
128 0.09
129 0.07
130 0.06
131 0.06
132 0.06
133 0.06
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.06
141 0.06
142 0.07
143 0.09
144 0.16
145 0.22
146 0.33
147 0.42
148 0.49
149 0.58
150 0.68
151 0.78
152 0.83
153 0.87
154 0.88
155 0.9
156 0.92
157 0.94
158 0.94
159 0.94
160 0.93
161 0.93
162 0.92