Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8T5K5

Protein Details
Accession A0A3D8T5K5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-30APFPAPHYPRERPQRRTPGREMKVLCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR040632  Sulfotransfer_4  
Pfam View protein in Pfam  
PF17784  Sulfotransfer_4  
Amino Acid Sequences MAANAPFPAPHYPRERPQRRTPGREMKVLCLGLPQTGTLTLYRALNTLGYNTYHLTEACLDYQNDALVLWNTALRAKYYIPELRSFEGADFERMLWRYDAVIDMPASLFIHELMDAYPDAQIILNTAKDADSWVMSMENSYYKIIKMKRLWLLAFVDTIYLRPFRRLLRSTLNLYTQGKRTRNKNHLPAYYKAHNAHVRGAAQLRGRKVLEYNIKQGWKPLCEFLNREIPKEDFPVSAEEDFIVGYQYIVVWWRVWEVFWRAAIVWAVWRVLEGVASIYWGLPETQYGMEYLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.69
4 0.77
5 0.82
6 0.83
7 0.86
8 0.87
9 0.87
10 0.82
11 0.82
12 0.74
13 0.68
14 0.66
15 0.57
16 0.46
17 0.39
18 0.34
19 0.28
20 0.25
21 0.2
22 0.13
23 0.13
24 0.14
25 0.11
26 0.12
27 0.13
28 0.13
29 0.14
30 0.13
31 0.13
32 0.13
33 0.13
34 0.14
35 0.14
36 0.13
37 0.15
38 0.15
39 0.16
40 0.15
41 0.14
42 0.14
43 0.14
44 0.15
45 0.15
46 0.18
47 0.17
48 0.16
49 0.17
50 0.15
51 0.13
52 0.11
53 0.1
54 0.07
55 0.08
56 0.07
57 0.07
58 0.07
59 0.1
60 0.1
61 0.1
62 0.11
63 0.12
64 0.13
65 0.19
66 0.23
67 0.23
68 0.28
69 0.3
70 0.3
71 0.3
72 0.29
73 0.23
74 0.22
75 0.21
76 0.18
77 0.15
78 0.14
79 0.16
80 0.16
81 0.17
82 0.13
83 0.13
84 0.11
85 0.11
86 0.12
87 0.09
88 0.1
89 0.08
90 0.08
91 0.08
92 0.08
93 0.07
94 0.06
95 0.06
96 0.05
97 0.05
98 0.05
99 0.05
100 0.04
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.06
122 0.05
123 0.06
124 0.06
125 0.06
126 0.07
127 0.08
128 0.08
129 0.08
130 0.13
131 0.15
132 0.21
133 0.23
134 0.28
135 0.31
136 0.34
137 0.34
138 0.31
139 0.31
140 0.25
141 0.23
142 0.17
143 0.13
144 0.1
145 0.1
146 0.08
147 0.09
148 0.09
149 0.1
150 0.13
151 0.15
152 0.23
153 0.24
154 0.28
155 0.33
156 0.37
157 0.4
158 0.4
159 0.39
160 0.36
161 0.36
162 0.35
163 0.33
164 0.36
165 0.38
166 0.41
167 0.47
168 0.53
169 0.6
170 0.66
171 0.69
172 0.7
173 0.71
174 0.71
175 0.67
176 0.64
177 0.59
178 0.55
179 0.47
180 0.46
181 0.43
182 0.39
183 0.39
184 0.35
185 0.31
186 0.28
187 0.28
188 0.25
189 0.26
190 0.28
191 0.26
192 0.27
193 0.27
194 0.26
195 0.26
196 0.3
197 0.35
198 0.35
199 0.39
200 0.41
201 0.43
202 0.42
203 0.46
204 0.43
205 0.36
206 0.34
207 0.33
208 0.31
209 0.33
210 0.36
211 0.34
212 0.4
213 0.38
214 0.38
215 0.37
216 0.35
217 0.33
218 0.34
219 0.31
220 0.21
221 0.22
222 0.23
223 0.23
224 0.21
225 0.19
226 0.15
227 0.13
228 0.13
229 0.11
230 0.09
231 0.06
232 0.05
233 0.05
234 0.05
235 0.05
236 0.07
237 0.08
238 0.07
239 0.08
240 0.11
241 0.11
242 0.12
243 0.16
244 0.2
245 0.22
246 0.22
247 0.23
248 0.21
249 0.23
250 0.24
251 0.19
252 0.17
253 0.16
254 0.15
255 0.13
256 0.13
257 0.12
258 0.11
259 0.11
260 0.08
261 0.08
262 0.07
263 0.08
264 0.08
265 0.07
266 0.07
267 0.08
268 0.08
269 0.07
270 0.08
271 0.1
272 0.11
273 0.11