Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8RKK0

Protein Details
Accession A0A3D8RKK0    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
374-393ITDRVWSRKRRSRILSLAKEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 12, mito 11.5, cyto 11.5, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020471  AKR  
IPR044480  Ara2-like  
IPR023210  NADP_OxRdtase_dom  
IPR036812  NADP_OxRdtase_dom_sf  
Gene Ontology GO:0045290  F:D-arabinose 1-dehydrogenase [NAD(P)+] activity  
Pfam View protein in Pfam  
PF00248  Aldo_ket_red  
CDD cd19164  AKR_ARA2  
Amino Acid Sequences MAQDTVRAPLSATLPPLIMGTATFNSQYNEDPYALPTTELVHRALASGVRAFDTSPYYGPAENLLGRALATDFVQSNFPRSSYHLLTKVGRIAGSSFDYSPKWVRKSVARSLRRLHTEYLDVVYCHDVEFVPAAEVLDAVRELRRIRDTEGTIRYVGISGYPVNVLCDLSELVLRETGEPLDAVMSYANFTLQNTRLLTQGLPRLTAAGVDVIPNASPLGMGLLRRKGVPIGSMGDFHPAPDGLRTAIHNAAEWADTQGEKIEVIAIRFALESWLREGAKGGALGPPLARTPGSDPSFLSVASMGTGERLGVSVMGVSNIEELTETLRVWHSIVDGLENKDDNDTEYFENKAEAASIPSAPSAPAILTPSDGIITDRVWSRKRRSRILSLAKEIQSILSPTWVDYTWPSPGPDFVNTLPAEHIAALNQEPEKSSTSVLPDAEQAMMTPPLDAHEQEIEIPAGNVPSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.15
5 0.12
6 0.09
7 0.11
8 0.11
9 0.12
10 0.13
11 0.14
12 0.16
13 0.17
14 0.19
15 0.19
16 0.21
17 0.21
18 0.21
19 0.22
20 0.24
21 0.23
22 0.21
23 0.17
24 0.18
25 0.2
26 0.22
27 0.21
28 0.18
29 0.18
30 0.18
31 0.19
32 0.17
33 0.15
34 0.15
35 0.15
36 0.15
37 0.15
38 0.14
39 0.15
40 0.17
41 0.17
42 0.15
43 0.17
44 0.18
45 0.19
46 0.19
47 0.19
48 0.19
49 0.18
50 0.18
51 0.15
52 0.13
53 0.13
54 0.13
55 0.11
56 0.08
57 0.08
58 0.09
59 0.1
60 0.11
61 0.16
62 0.15
63 0.19
64 0.19
65 0.2
66 0.19
67 0.22
68 0.28
69 0.29
70 0.35
71 0.35
72 0.38
73 0.4
74 0.41
75 0.41
76 0.36
77 0.31
78 0.25
79 0.21
80 0.2
81 0.21
82 0.2
83 0.16
84 0.17
85 0.18
86 0.2
87 0.27
88 0.3
89 0.31
90 0.32
91 0.35
92 0.41
93 0.48
94 0.55
95 0.59
96 0.58
97 0.62
98 0.65
99 0.69
100 0.67
101 0.63
102 0.55
103 0.48
104 0.44
105 0.39
106 0.35
107 0.28
108 0.22
109 0.2
110 0.18
111 0.15
112 0.12
113 0.11
114 0.08
115 0.08
116 0.09
117 0.08
118 0.07
119 0.07
120 0.07
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.05
127 0.06
128 0.08
129 0.09
130 0.13
131 0.17
132 0.18
133 0.21
134 0.27
135 0.3
136 0.35
137 0.38
138 0.36
139 0.33
140 0.31
141 0.28
142 0.21
143 0.18
144 0.11
145 0.08
146 0.07
147 0.07
148 0.07
149 0.07
150 0.07
151 0.08
152 0.08
153 0.06
154 0.07
155 0.07
156 0.06
157 0.08
158 0.07
159 0.07
160 0.09
161 0.09
162 0.09
163 0.09
164 0.09
165 0.08
166 0.07
167 0.07
168 0.06
169 0.05
170 0.05
171 0.04
172 0.04
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.09
179 0.1
180 0.14
181 0.14
182 0.15
183 0.15
184 0.16
185 0.16
186 0.16
187 0.19
188 0.16
189 0.15
190 0.15
191 0.15
192 0.14
193 0.13
194 0.1
195 0.06
196 0.06
197 0.06
198 0.06
199 0.05
200 0.05
201 0.05
202 0.05
203 0.03
204 0.03
205 0.03
206 0.04
207 0.05
208 0.06
209 0.08
210 0.11
211 0.11
212 0.12
213 0.12
214 0.12
215 0.11
216 0.11
217 0.1
218 0.11
219 0.11
220 0.12
221 0.12
222 0.13
223 0.13
224 0.12
225 0.11
226 0.08
227 0.08
228 0.07
229 0.07
230 0.06
231 0.07
232 0.07
233 0.09
234 0.11
235 0.11
236 0.1
237 0.1
238 0.1
239 0.09
240 0.09
241 0.08
242 0.07
243 0.06
244 0.07
245 0.07
246 0.06
247 0.06
248 0.05
249 0.07
250 0.07
251 0.07
252 0.08
253 0.07
254 0.07
255 0.07
256 0.07
257 0.07
258 0.07
259 0.07
260 0.08
261 0.12
262 0.12
263 0.12
264 0.13
265 0.12
266 0.13
267 0.12
268 0.11
269 0.09
270 0.09
271 0.1
272 0.09
273 0.09
274 0.08
275 0.09
276 0.08
277 0.07
278 0.11
279 0.19
280 0.21
281 0.21
282 0.21
283 0.22
284 0.23
285 0.21
286 0.18
287 0.1
288 0.08
289 0.07
290 0.07
291 0.05
292 0.05
293 0.05
294 0.04
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.05
306 0.05
307 0.05
308 0.04
309 0.04
310 0.06
311 0.07
312 0.07
313 0.07
314 0.08
315 0.09
316 0.09
317 0.1
318 0.08
319 0.1
320 0.1
321 0.13
322 0.15
323 0.16
324 0.18
325 0.18
326 0.18
327 0.16
328 0.16
329 0.14
330 0.13
331 0.14
332 0.14
333 0.15
334 0.16
335 0.15
336 0.16
337 0.14
338 0.12
339 0.1
340 0.09
341 0.09
342 0.1
343 0.1
344 0.1
345 0.11
346 0.11
347 0.1
348 0.1
349 0.08
350 0.07
351 0.08
352 0.09
353 0.09
354 0.1
355 0.1
356 0.1
357 0.1
358 0.1
359 0.09
360 0.08
361 0.08
362 0.1
363 0.15
364 0.2
365 0.25
366 0.33
367 0.42
368 0.5
369 0.58
370 0.66
371 0.69
372 0.73
373 0.79
374 0.82
375 0.8
376 0.78
377 0.78
378 0.69
379 0.62
380 0.52
381 0.42
382 0.33
383 0.26
384 0.19
385 0.15
386 0.14
387 0.14
388 0.16
389 0.15
390 0.14
391 0.15
392 0.18
393 0.19
394 0.21
395 0.22
396 0.2
397 0.23
398 0.25
399 0.24
400 0.26
401 0.22
402 0.27
403 0.25
404 0.26
405 0.24
406 0.21
407 0.2
408 0.16
409 0.16
410 0.1
411 0.12
412 0.11
413 0.14
414 0.15
415 0.15
416 0.16
417 0.18
418 0.21
419 0.2
420 0.21
421 0.2
422 0.24
423 0.27
424 0.26
425 0.25
426 0.23
427 0.23
428 0.22
429 0.19
430 0.15
431 0.14
432 0.15
433 0.13
434 0.12
435 0.1
436 0.12
437 0.15
438 0.15
439 0.15
440 0.16
441 0.17
442 0.17
443 0.19
444 0.18
445 0.16
446 0.16
447 0.13