Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N2W0

Protein Details
Accession B8N2W0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
107-126GKPAEIIVRDKRRKPKSPAKBasic
NLS Segment(s)
PositionSequence
108-126KPAEIIVRDKRRKPKSPAK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041966  LOTUS-like  
IPR025605  OST-HTH/LOTUS_dom  
Pfam View protein in Pfam  
PF12872  OST-HTH  
PROSITE View protein in PROSITE  
PS51644  HTH_OST  
CDD cd10146  LabA_like_C  
Amino Acid Sequences MTGDTIPKLVVLIDADNARSSVVDPLLSEIAKYALQAHKDDHLATQLRTTVEATSDDDGWARLSQVGGLLTEKYPDFDSRTYGYYKLSDLIAASSLFETSRRSFREGKPAEIIVRDKRRKPKSPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.13
5 0.12
6 0.1
7 0.1
8 0.1
9 0.1
10 0.1
11 0.09
12 0.12
13 0.14
14 0.14
15 0.13
16 0.1
17 0.11
18 0.1
19 0.1
20 0.12
21 0.13
22 0.16
23 0.17
24 0.18
25 0.2
26 0.21
27 0.21
28 0.17
29 0.19
30 0.19
31 0.18
32 0.18
33 0.17
34 0.17
35 0.17
36 0.17
37 0.12
38 0.11
39 0.12
40 0.12
41 0.11
42 0.11
43 0.1
44 0.09
45 0.09
46 0.09
47 0.08
48 0.07
49 0.06
50 0.05
51 0.05
52 0.06
53 0.06
54 0.05
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.09
62 0.1
63 0.12
64 0.12
65 0.15
66 0.16
67 0.18
68 0.18
69 0.18
70 0.18
71 0.16
72 0.17
73 0.15
74 0.13
75 0.11
76 0.1
77 0.1
78 0.1
79 0.08
80 0.08
81 0.07
82 0.07
83 0.07
84 0.08
85 0.11
86 0.13
87 0.2
88 0.22
89 0.27
90 0.34
91 0.38
92 0.49
93 0.48
94 0.5
95 0.48
96 0.48
97 0.46
98 0.44
99 0.45
100 0.44
101 0.51
102 0.54
103 0.58
104 0.65
105 0.73
106 0.78