Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8RQQ8

Protein Details
Accession A0A3D8RQQ8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-69LRAVPKKKTSHMKKRHRQMAGKBasic
NLS Segment(s)
PositionSequence
52-68PKKKTSHMKKRHRQMAG
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MPQFSIPSRSFTTGLSSHPSIFLSATLRPAAFSLNVPGILSDIWESVLRAVPKKKTSHMKKRHRQMAGKALKDVKNLNTCPACGQIKRSHVLCHHCVESIKKQWGKAQLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.28
4 0.25
5 0.25
6 0.25
7 0.19
8 0.18
9 0.17
10 0.13
11 0.13
12 0.14
13 0.14
14 0.14
15 0.13
16 0.13
17 0.13
18 0.11
19 0.11
20 0.11
21 0.11
22 0.11
23 0.1
24 0.1
25 0.09
26 0.08
27 0.08
28 0.06
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.09
35 0.1
36 0.13
37 0.16
38 0.2
39 0.25
40 0.28
41 0.33
42 0.41
43 0.5
44 0.58
45 0.65
46 0.72
47 0.76
48 0.84
49 0.86
50 0.83
51 0.79
52 0.75
53 0.75
54 0.73
55 0.65
56 0.59
57 0.56
58 0.51
59 0.48
60 0.43
61 0.38
62 0.38
63 0.37
64 0.39
65 0.34
66 0.32
67 0.31
68 0.34
69 0.32
70 0.26
71 0.31
72 0.32
73 0.35
74 0.4
75 0.4
76 0.4
77 0.42
78 0.48
79 0.47
80 0.45
81 0.41
82 0.39
83 0.4
84 0.41
85 0.44
86 0.45
87 0.51
88 0.49
89 0.5
90 0.54