Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8Q889

Protein Details
Accession A0A3D8Q889    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-36GPTITNTASRHNKNKNKKQTPTAAPLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.833, nucl 8.5, cyto 8, cyto_mito 7.999, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
Amino Acid Sequences MSAVNESGYQGPTITNTASRHNKNKNKKQTPTAAPLQFHGGGMIMGSAAEQKLIPQTLVHLSRVPIFDVEYRLASSGYIHRGWNAGCLPYECVVYASKLAGAGVQTKFHFPCGLGCRME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.17
4 0.26
5 0.34
6 0.41
7 0.49
8 0.58
9 0.67
10 0.73
11 0.82
12 0.85
13 0.86
14 0.87
15 0.85
16 0.85
17 0.82
18 0.78
19 0.76
20 0.69
21 0.59
22 0.52
23 0.48
24 0.39
25 0.31
26 0.24
27 0.15
28 0.1
29 0.09
30 0.08
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.05
40 0.06
41 0.06
42 0.05
43 0.07
44 0.11
45 0.13
46 0.13
47 0.13
48 0.13
49 0.16
50 0.16
51 0.15
52 0.11
53 0.11
54 0.12
55 0.13
56 0.13
57 0.11
58 0.11
59 0.11
60 0.11
61 0.09
62 0.1
63 0.1
64 0.13
65 0.14
66 0.14
67 0.14
68 0.16
69 0.16
70 0.19
71 0.17
72 0.15
73 0.14
74 0.15
75 0.17
76 0.16
77 0.17
78 0.13
79 0.13
80 0.13
81 0.13
82 0.12
83 0.1
84 0.1
85 0.09
86 0.09
87 0.09
88 0.09
89 0.13
90 0.14
91 0.17
92 0.18
93 0.22
94 0.23
95 0.24
96 0.24
97 0.19
98 0.26
99 0.29