Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N9S8

Protein Details
Accession B8N9S8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-108KRATYNPSRRVQKRRHGFLARHydrophilic
NLS Segment(s)
PositionSequence
95-128SRRVQKRRHGFLARVRSRGGRMIILRRRAKGRKS
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCFRCRAMPSALRTYSSPMSMSRYLTPKTTTTTPFSTLSSPLRPMTNFTTTIRPQLQTLSNTQLPSAATPSAQQTRSFSASASLAGKRATYNPSRRVQKRRHGFLARVRSRGGRMIILRRRAKGRKSLSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.4
4 0.34
5 0.29
6 0.22
7 0.26
8 0.26
9 0.28
10 0.28
11 0.3
12 0.3
13 0.32
14 0.33
15 0.29
16 0.32
17 0.34
18 0.32
19 0.32
20 0.34
21 0.34
22 0.33
23 0.32
24 0.29
25 0.28
26 0.28
27 0.25
28 0.25
29 0.22
30 0.23
31 0.22
32 0.24
33 0.25
34 0.25
35 0.25
36 0.24
37 0.3
38 0.28
39 0.33
40 0.32
41 0.27
42 0.24
43 0.25
44 0.27
45 0.21
46 0.23
47 0.23
48 0.23
49 0.22
50 0.22
51 0.19
52 0.16
53 0.15
54 0.14
55 0.09
56 0.07
57 0.08
58 0.11
59 0.15
60 0.16
61 0.16
62 0.17
63 0.2
64 0.22
65 0.22
66 0.18
67 0.16
68 0.15
69 0.16
70 0.16
71 0.13
72 0.12
73 0.12
74 0.12
75 0.11
76 0.14
77 0.17
78 0.23
79 0.31
80 0.37
81 0.46
82 0.55
83 0.63
84 0.7
85 0.74
86 0.77
87 0.8
88 0.8
89 0.81
90 0.78
91 0.77
92 0.76
93 0.78
94 0.73
95 0.66
96 0.6
97 0.53
98 0.49
99 0.48
100 0.41
101 0.36
102 0.36
103 0.43
104 0.49
105 0.56
106 0.59
107 0.59
108 0.67
109 0.68
110 0.7
111 0.69