Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8T4R7

Protein Details
Accession A0A3D8T4R7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
28-48LYSKLKMRRKHLDHGRRRKDLBasic
NLS Segment(s)
PositionSequence
33-45KMRRKHLDHGRRR
Subcellular Location(s) nucl 14, mito 6, cyto 4, plas 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MTSNCINIASAAPAPVASASAPSELLHLYSKLKMRRKHLDHGRRRKDLSGIMHFWPDVPVDDFTLNLEEPASVHSLPITRSNQGTPRRAWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.06
5 0.07
6 0.07
7 0.08
8 0.08
9 0.08
10 0.09
11 0.09
12 0.1
13 0.1
14 0.1
15 0.11
16 0.14
17 0.2
18 0.27
19 0.34
20 0.38
21 0.45
22 0.54
23 0.58
24 0.65
25 0.7
26 0.73
27 0.76
28 0.82
29 0.83
30 0.78
31 0.74
32 0.65
33 0.57
34 0.52
35 0.47
36 0.42
37 0.36
38 0.32
39 0.3
40 0.29
41 0.26
42 0.21
43 0.15
44 0.11
45 0.1
46 0.1
47 0.1
48 0.11
49 0.11
50 0.11
51 0.12
52 0.11
53 0.09
54 0.08
55 0.06
56 0.07
57 0.08
58 0.1
59 0.08
60 0.08
61 0.1
62 0.11
63 0.13
64 0.2
65 0.22
66 0.22
67 0.25
68 0.3
69 0.37
70 0.44
71 0.48