Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NZ38

Protein Details
Accession B8NZ38    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-97SWSSRSRSRSRGSRRCRDRSYSHydrophilic
NLS Segment(s)
PositionSequence
50-90RRNGYRSRSRSRSASRSRMLSRSRSRSWSSRSRSRSRGSRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSATARGRSPNRSPLDPGPEQASTPMRRTMSPRSESRPGSERSPSSDHVRRNGYRSRSRSRSASRSRMLSRSRSRSWSSRSRSRSRGSRRCRDRSYSETPSPSDNLPRSSKVCAIAHCCPICALYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.53
4 0.49
5 0.44
6 0.39
7 0.35
8 0.33
9 0.33
10 0.28
11 0.29
12 0.32
13 0.29
14 0.3
15 0.35
16 0.41
17 0.43
18 0.46
19 0.48
20 0.5
21 0.56
22 0.55
23 0.54
24 0.51
25 0.45
26 0.43
27 0.44
28 0.38
29 0.36
30 0.39
31 0.37
32 0.39
33 0.42
34 0.4
35 0.4
36 0.46
37 0.43
38 0.44
39 0.48
40 0.48
41 0.5
42 0.54
43 0.57
44 0.56
45 0.57
46 0.6
47 0.59
48 0.62
49 0.61
50 0.62
51 0.56
52 0.57
53 0.56
54 0.56
55 0.53
56 0.52
57 0.52
58 0.52
59 0.52
60 0.51
61 0.53
62 0.52
63 0.55
64 0.56
65 0.55
66 0.57
67 0.62
68 0.64
69 0.67
70 0.68
71 0.71
72 0.73
73 0.76
74 0.76
75 0.79
76 0.81
77 0.84
78 0.83
79 0.8
80 0.76
81 0.74
82 0.73
83 0.71
84 0.67
85 0.61
86 0.56
87 0.52
88 0.46
89 0.41
90 0.4
91 0.35
92 0.34
93 0.35
94 0.38
95 0.38
96 0.4
97 0.41
98 0.39
99 0.39
100 0.39
101 0.42
102 0.43
103 0.49
104 0.46
105 0.43
106 0.37