Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8R9M4

Protein Details
Accession A0A3D8R9M4    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
110-153AEAPSAPKKTPKKRRAPAAKADGKEPTPKKKRGRPAKVKVQVETHydrophilic
NLS Segment(s)
PositionSequence
115-147APKKTPKKRRAPAAKADGKEPTPKKKRGRPAKV
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
Amino Acid Sequences MQSVKGPGKMSLTADDHVELLLSCVNRTDGSKIDFAAVAQDCNITSAGAAAKRYHRLLKSHREAKASANASGSSSADVGTNEPVHDNDNSNDNANANDNADGEAEAEAEAEAPSAPKKTPKKRRAPAAKADGKEPTPKKKRGRPAKVKVQVETAAAVKQEEQEDGEMQNNVSVDINVNVKEEVAEEEMPDVAPAGCGEAVDGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.23
4 0.19
5 0.17
6 0.11
7 0.09
8 0.11
9 0.09
10 0.09
11 0.09
12 0.11
13 0.12
14 0.13
15 0.16
16 0.17
17 0.2
18 0.21
19 0.21
20 0.21
21 0.2
22 0.18
23 0.21
24 0.17
25 0.15
26 0.13
27 0.14
28 0.12
29 0.13
30 0.13
31 0.07
32 0.06
33 0.07
34 0.09
35 0.1
36 0.12
37 0.13
38 0.17
39 0.21
40 0.25
41 0.29
42 0.3
43 0.36
44 0.43
45 0.52
46 0.58
47 0.62
48 0.63
49 0.6
50 0.58
51 0.54
52 0.54
53 0.46
54 0.37
55 0.31
56 0.27
57 0.24
58 0.24
59 0.2
60 0.12
61 0.1
62 0.08
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.09
71 0.1
72 0.1
73 0.11
74 0.1
75 0.13
76 0.14
77 0.14
78 0.14
79 0.12
80 0.12
81 0.12
82 0.12
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.07
89 0.06
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.03
99 0.04
100 0.04
101 0.05
102 0.06
103 0.14
104 0.23
105 0.34
106 0.45
107 0.55
108 0.66
109 0.72
110 0.82
111 0.86
112 0.84
113 0.83
114 0.83
115 0.79
116 0.69
117 0.64
118 0.56
119 0.47
120 0.48
121 0.44
122 0.44
123 0.46
124 0.54
125 0.61
126 0.66
127 0.75
128 0.78
129 0.84
130 0.85
131 0.86
132 0.88
133 0.88
134 0.84
135 0.75
136 0.68
137 0.59
138 0.48
139 0.4
140 0.3
141 0.22
142 0.18
143 0.16
144 0.12
145 0.13
146 0.13
147 0.12
148 0.12
149 0.12
150 0.13
151 0.14
152 0.15
153 0.13
154 0.13
155 0.13
156 0.12
157 0.11
158 0.11
159 0.1
160 0.09
161 0.1
162 0.13
163 0.12
164 0.13
165 0.12
166 0.12
167 0.12
168 0.11
169 0.12
170 0.13
171 0.13
172 0.12
173 0.13
174 0.13
175 0.13
176 0.12
177 0.1
178 0.06
179 0.07
180 0.06
181 0.08
182 0.07
183 0.07
184 0.08