Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8R9G7

Protein Details
Accession A0A3D8R9G7    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
121-141KEDERKGEKKEDVKKKERYREBasic
NLS Segment(s)
PositionSequence
85-112GKKKHGAEGGMREGEKKEGEKKEYRVEG
115-141MKEGEEKEDERKGEKKEDVKKKERYRE
Subcellular Location(s) mito 16.5, cyto_mito 11, cyto 4.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002557  Chitin-bd_dom  
IPR036508  Chitin-bd_dom_sf  
Gene Ontology GO:0005576  C:extracellular region  
GO:0008061  F:chitin binding  
Pfam View protein in Pfam  
PF01607  CBM_14  
PROSITE View protein in PROSITE  
PS50940  CHIT_BIND_II  
Amino Acid Sequences MQLPINTLTLLAASLLIATSTAAPTDPTCHVGATWPDHHDCHRFYECAAGGTPVRKTCGPHTAYSAELGVCDYEWRVSTCRRGYGKKKHGAEGGMREGEKKEGEKKEYRVEGVEMKEGEEKEDERKGEKKEDVKKKERYRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.07
12 0.11
13 0.12
14 0.14
15 0.15
16 0.15
17 0.15
18 0.18
19 0.21
20 0.22
21 0.24
22 0.24
23 0.25
24 0.26
25 0.29
26 0.3
27 0.28
28 0.3
29 0.29
30 0.27
31 0.25
32 0.29
33 0.27
34 0.23
35 0.22
36 0.17
37 0.15
38 0.17
39 0.19
40 0.14
41 0.16
42 0.15
43 0.17
44 0.19
45 0.27
46 0.27
47 0.26
48 0.29
49 0.28
50 0.27
51 0.26
52 0.23
53 0.14
54 0.11
55 0.1
56 0.06
57 0.05
58 0.05
59 0.04
60 0.04
61 0.05
62 0.06
63 0.08
64 0.1
65 0.17
66 0.19
67 0.25
68 0.29
69 0.37
70 0.45
71 0.54
72 0.62
73 0.64
74 0.65
75 0.62
76 0.61
77 0.56
78 0.51
79 0.46
80 0.41
81 0.35
82 0.32
83 0.29
84 0.27
85 0.26
86 0.23
87 0.2
88 0.24
89 0.27
90 0.33
91 0.39
92 0.43
93 0.49
94 0.51
95 0.49
96 0.43
97 0.4
98 0.39
99 0.35
100 0.35
101 0.27
102 0.25
103 0.28
104 0.26
105 0.25
106 0.22
107 0.21
108 0.21
109 0.26
110 0.26
111 0.27
112 0.33
113 0.36
114 0.41
115 0.47
116 0.51
117 0.56
118 0.66
119 0.72
120 0.75
121 0.82