Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N064

Protein Details
Accession B8N064    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
74-96KVVNTGKKTHKKSWKRMITKPTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 12, mito 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0005840  C:ribosome  
GO:0000466  P:maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
Amino Acid Sequences MRKRIKAQEEKNVKSSAPDEPSKTPLPQYLLDRSQATNAKALSSAIKDKRKEQAAKFAVPLPKVKGISEEEMFKVVNTGKKTHKKSWKRMITKPTFVGNDFTRVNPKRERFIRPMGLRYKKANVTHPELGVTVQLPIISVKKNPQNPLYTSLGVLTKGTIVEVNVSELGLVTTSGRVVWGKYAQISNNPENDGCVNAVLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.46
3 0.42
4 0.38
5 0.38
6 0.37
7 0.39
8 0.44
9 0.44
10 0.44
11 0.38
12 0.36
13 0.36
14 0.35
15 0.37
16 0.39
17 0.38
18 0.4
19 0.39
20 0.35
21 0.38
22 0.38
23 0.34
24 0.3
25 0.27
26 0.25
27 0.23
28 0.23
29 0.19
30 0.18
31 0.25
32 0.29
33 0.37
34 0.38
35 0.42
36 0.5
37 0.56
38 0.6
39 0.55
40 0.58
41 0.55
42 0.56
43 0.53
44 0.5
45 0.45
46 0.39
47 0.39
48 0.31
49 0.31
50 0.3
51 0.28
52 0.26
53 0.26
54 0.28
55 0.27
56 0.25
57 0.2
58 0.21
59 0.2
60 0.16
61 0.15
62 0.13
63 0.16
64 0.16
65 0.19
66 0.27
67 0.36
68 0.43
69 0.5
70 0.59
71 0.65
72 0.73
73 0.8
74 0.81
75 0.8
76 0.81
77 0.82
78 0.78
79 0.73
80 0.65
81 0.59
82 0.5
83 0.43
84 0.39
85 0.29
86 0.26
87 0.22
88 0.2
89 0.25
90 0.25
91 0.29
92 0.32
93 0.33
94 0.37
95 0.42
96 0.48
97 0.45
98 0.5
99 0.55
100 0.51
101 0.56
102 0.57
103 0.58
104 0.54
105 0.52
106 0.5
107 0.47
108 0.47
109 0.48
110 0.44
111 0.45
112 0.45
113 0.42
114 0.38
115 0.32
116 0.29
117 0.22
118 0.17
119 0.1
120 0.07
121 0.06
122 0.06
123 0.06
124 0.08
125 0.09
126 0.1
127 0.16
128 0.23
129 0.29
130 0.33
131 0.37
132 0.41
133 0.42
134 0.46
135 0.45
136 0.38
137 0.33
138 0.31
139 0.26
140 0.22
141 0.19
142 0.13
143 0.09
144 0.09
145 0.09
146 0.07
147 0.07
148 0.08
149 0.08
150 0.1
151 0.09
152 0.09
153 0.09
154 0.08
155 0.08
156 0.06
157 0.06
158 0.05
159 0.05
160 0.05
161 0.05
162 0.07
163 0.07
164 0.08
165 0.12
166 0.15
167 0.16
168 0.2
169 0.24
170 0.25
171 0.32
172 0.39
173 0.4
174 0.41
175 0.41
176 0.38
177 0.36
178 0.35
179 0.29
180 0.23
181 0.18