Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NL36

Protein Details
Accession B8NL36    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
88-108ATSARKLKSSERRRQAKERGIHydrophilic
NLS Segment(s)
PositionSequence
95-104KSSERRRQAK
Subcellular Location(s) nucl 11.5, cysk 10, cyto_nucl 8.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
CDD cd09917  F-box_SF  
Amino Acid Sequences MELDSTTKALSLWEILHPILLNLDMRTLLHAQRVCRVWYHIITRSRSLQQALFFLPVEESQATGPVKRIDQINPLLKEILWPQLSWLATSARKLKSSERRRQAKERGIPTLRSETASWRRMLIRQPPPITIGIQGEDEDDANSPAPTIYYNEDISTECLWVLTEISTFADHCFVQCIFSGDDGWKEIYPPEQVDLVSEQDLQKCDMLLVGYCPPNYLLRMIQWILRYAYYDPRLSLRVDIHPPMLDFYYRFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.16
5 0.15
6 0.13
7 0.12
8 0.12
9 0.09
10 0.1
11 0.09
12 0.1
13 0.12
14 0.15
15 0.15
16 0.2
17 0.22
18 0.23
19 0.3
20 0.33
21 0.31
22 0.3
23 0.33
24 0.32
25 0.35
26 0.4
27 0.41
28 0.45
29 0.47
30 0.49
31 0.5
32 0.49
33 0.46
34 0.43
35 0.38
36 0.33
37 0.32
38 0.3
39 0.26
40 0.22
41 0.19
42 0.17
43 0.14
44 0.15
45 0.12
46 0.11
47 0.09
48 0.13
49 0.14
50 0.13
51 0.16
52 0.15
53 0.16
54 0.18
55 0.21
56 0.19
57 0.24
58 0.31
59 0.37
60 0.36
61 0.36
62 0.34
63 0.31
64 0.31
65 0.26
66 0.25
67 0.18
68 0.16
69 0.16
70 0.2
71 0.2
72 0.18
73 0.18
74 0.15
75 0.15
76 0.19
77 0.24
78 0.22
79 0.25
80 0.26
81 0.34
82 0.41
83 0.51
84 0.57
85 0.61
86 0.68
87 0.73
88 0.8
89 0.81
90 0.8
91 0.77
92 0.71
93 0.7
94 0.63
95 0.58
96 0.52
97 0.48
98 0.39
99 0.33
100 0.29
101 0.28
102 0.32
103 0.34
104 0.31
105 0.27
106 0.28
107 0.29
108 0.34
109 0.36
110 0.36
111 0.4
112 0.41
113 0.4
114 0.41
115 0.39
116 0.34
117 0.26
118 0.19
119 0.13
120 0.11
121 0.11
122 0.09
123 0.08
124 0.08
125 0.06
126 0.06
127 0.05
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.08
136 0.1
137 0.11
138 0.11
139 0.12
140 0.13
141 0.15
142 0.13
143 0.11
144 0.09
145 0.08
146 0.08
147 0.07
148 0.07
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.07
155 0.07
156 0.08
157 0.08
158 0.08
159 0.1
160 0.09
161 0.1
162 0.1
163 0.12
164 0.11
165 0.12
166 0.13
167 0.11
168 0.12
169 0.12
170 0.13
171 0.11
172 0.11
173 0.11
174 0.12
175 0.14
176 0.14
177 0.14
178 0.14
179 0.14
180 0.15
181 0.16
182 0.15
183 0.14
184 0.15
185 0.15
186 0.16
187 0.17
188 0.17
189 0.16
190 0.14
191 0.13
192 0.12
193 0.11
194 0.09
195 0.11
196 0.14
197 0.16
198 0.16
199 0.17
200 0.17
201 0.19
202 0.19
203 0.2
204 0.17
205 0.16
206 0.22
207 0.22
208 0.24
209 0.24
210 0.25
211 0.25
212 0.23
213 0.24
214 0.21
215 0.29
216 0.3
217 0.3
218 0.28
219 0.3
220 0.32
221 0.31
222 0.33
223 0.28
224 0.31
225 0.35
226 0.36
227 0.35
228 0.35
229 0.34
230 0.33
231 0.31
232 0.25