Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8ND01

Protein Details
Accession B8ND01    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
84-123TQGRSHKGGRIHKRHSNRKNRSSIVFRPHQSKNKKGLKRRBasic
NLS Segment(s)
PositionSequence
87-123RSHKGGRIHKRHSNRKNRSSIVFRPHQSKNKKGLKRR
Subcellular Location(s) mito 16.5, mito_nucl 13.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSVRASVQKRNRAKLRATVFGPVVDARTERLSAKLQELASQPKPSNEEKPDMELNMKDRQEGTKISQTSEDMDIDNGTIKTTQGRSHKGGRIHKRHSNRKNRSSIVFRPHQSKNKKGLKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.74
4 0.69
5 0.66
6 0.6
7 0.54
8 0.47
9 0.4
10 0.37
11 0.28
12 0.23
13 0.16
14 0.15
15 0.12
16 0.13
17 0.14
18 0.13
19 0.16
20 0.18
21 0.19
22 0.21
23 0.23
24 0.22
25 0.24
26 0.26
27 0.3
28 0.29
29 0.32
30 0.3
31 0.28
32 0.32
33 0.31
34 0.35
35 0.32
36 0.33
37 0.3
38 0.34
39 0.33
40 0.3
41 0.28
42 0.22
43 0.22
44 0.23
45 0.22
46 0.18
47 0.18
48 0.18
49 0.19
50 0.19
51 0.2
52 0.2
53 0.21
54 0.21
55 0.22
56 0.21
57 0.21
58 0.21
59 0.18
60 0.11
61 0.11
62 0.1
63 0.09
64 0.11
65 0.08
66 0.07
67 0.07
68 0.07
69 0.1
70 0.12
71 0.17
72 0.22
73 0.27
74 0.31
75 0.39
76 0.44
77 0.49
78 0.57
79 0.62
80 0.66
81 0.69
82 0.74
83 0.77
84 0.83
85 0.85
86 0.87
87 0.87
88 0.87
89 0.88
90 0.84
91 0.82
92 0.79
93 0.77
94 0.75
95 0.72
96 0.67
97 0.64
98 0.68
99 0.7
100 0.7
101 0.71
102 0.72
103 0.74