Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8REZ5

Protein Details
Accession A0A3D8REZ5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-32SDYGEFCRDMRERKKRQREENPPPPRRSHDBasic
NLS Segment(s)
PositionSequence
15-23RKKRQREEN
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 11.5, mito 1, extr 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MVSDYGEFCRDMRERKKRQREENPPPPRRSHDWIIVMGTCHYAKNRSSFRTYERVGKRYYNEADPSGPGTYVAGIGTVFLKLRSSLEKNAPSHEVRLDNVLHIPDALCNGFNYPTYLKKTGRPGGGFMDCGFDQNGDPLWCSRKFRGMFRLVLAGNPQGESYLPEGGSFSVSMHLPLDDIIQEVETRKRNEQYGNADVSEDENWDGSEGSSVQKKVIYAMGPIVPVGTLFQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.71
3 0.82
4 0.85
5 0.91
6 0.93
7 0.94
8 0.94
9 0.94
10 0.94
11 0.92
12 0.88
13 0.82
14 0.78
15 0.74
16 0.71
17 0.67
18 0.64
19 0.59
20 0.56
21 0.52
22 0.46
23 0.4
24 0.33
25 0.29
26 0.2
27 0.17
28 0.17
29 0.18
30 0.19
31 0.27
32 0.34
33 0.36
34 0.4
35 0.42
36 0.46
37 0.51
38 0.51
39 0.52
40 0.52
41 0.52
42 0.51
43 0.52
44 0.5
45 0.49
46 0.5
47 0.46
48 0.41
49 0.39
50 0.36
51 0.32
52 0.31
53 0.24
54 0.2
55 0.14
56 0.11
57 0.1
58 0.08
59 0.07
60 0.05
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.07
70 0.12
71 0.15
72 0.2
73 0.26
74 0.33
75 0.33
76 0.36
77 0.38
78 0.34
79 0.32
80 0.31
81 0.25
82 0.19
83 0.21
84 0.19
85 0.15
86 0.15
87 0.14
88 0.11
89 0.09
90 0.09
91 0.06
92 0.07
93 0.07
94 0.06
95 0.05
96 0.06
97 0.07
98 0.07
99 0.09
100 0.09
101 0.13
102 0.17
103 0.21
104 0.21
105 0.25
106 0.32
107 0.35
108 0.38
109 0.35
110 0.33
111 0.33
112 0.33
113 0.29
114 0.22
115 0.2
116 0.15
117 0.15
118 0.14
119 0.1
120 0.09
121 0.09
122 0.1
123 0.07
124 0.08
125 0.09
126 0.13
127 0.15
128 0.19
129 0.19
130 0.26
131 0.28
132 0.32
133 0.4
134 0.41
135 0.4
136 0.38
137 0.41
138 0.33
139 0.31
140 0.28
141 0.21
142 0.16
143 0.15
144 0.13
145 0.09
146 0.09
147 0.1
148 0.1
149 0.1
150 0.1
151 0.1
152 0.1
153 0.1
154 0.11
155 0.09
156 0.08
157 0.07
158 0.08
159 0.08
160 0.08
161 0.08
162 0.07
163 0.07
164 0.08
165 0.06
166 0.07
167 0.06
168 0.06
169 0.07
170 0.09
171 0.15
172 0.2
173 0.23
174 0.28
175 0.32
176 0.35
177 0.4
178 0.45
179 0.47
180 0.47
181 0.47
182 0.42
183 0.38
184 0.34
185 0.31
186 0.25
187 0.18
188 0.13
189 0.1
190 0.09
191 0.1
192 0.1
193 0.08
194 0.09
195 0.09
196 0.12
197 0.17
198 0.17
199 0.17
200 0.19
201 0.19
202 0.19
203 0.23
204 0.21
205 0.17
206 0.21
207 0.22
208 0.2
209 0.2
210 0.18
211 0.14
212 0.12