Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8SJP2

Protein Details
Accession A0A3D8SJP2   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
302-330VETEKERDARRERRVERERVKDERRKEIEBasic
NLS Segment(s)
PositionSequence
193-205RRGTRKEAARAAK
307-337ERDARRERRVERERVKDERRKEIEKLRAKRR
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR025066  CCDC174-like  
Pfam View protein in Pfam  
PF13300  DUF4078  
Amino Acid Sequences MSKPSLYGQKPSKQQAKSTPSSSTLAFTTTLSSLIASGTSSDRSQGRPRPSKAPKSDLFSRPNKGAQKRAAADLRDDDTTVRQVHQSSKDIGSVDEATLHRSKRRMEEKAKQYEDLKKGLYLAGGSDSEDEGQQGGDAYLSRLRRKEREGLVDFDKKWADEREKHSGSDSDSEQEDNDNASIVSYEDELGRTRRGTRKEAARAAKEKAAAEGDAQDAERWRPSRPENLIYGVTVQSEAFRPTDIAAEQMAYLAKRRDRSPTPDEVHYDADAEVRNRGTGFYAFSKDEEVRKKQMEELLNARVETEKERDARRERRVERERVKDERRKEIEKLRAKRRAEMFLSGLGDIDIGVSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.72
3 0.73
4 0.71
5 0.67
6 0.61
7 0.56
8 0.54
9 0.47
10 0.39
11 0.3
12 0.25
13 0.22
14 0.18
15 0.17
16 0.15
17 0.14
18 0.12
19 0.11
20 0.1
21 0.09
22 0.09
23 0.06
24 0.08
25 0.09
26 0.11
27 0.11
28 0.15
29 0.17
30 0.22
31 0.3
32 0.37
33 0.46
34 0.53
35 0.58
36 0.65
37 0.73
38 0.78
39 0.78
40 0.79
41 0.73
42 0.71
43 0.76
44 0.73
45 0.71
46 0.68
47 0.65
48 0.6
49 0.62
50 0.63
51 0.6
52 0.61
53 0.59
54 0.61
55 0.58
56 0.61
57 0.59
58 0.51
59 0.49
60 0.44
61 0.4
62 0.32
63 0.3
64 0.23
65 0.2
66 0.23
67 0.21
68 0.17
69 0.17
70 0.19
71 0.25
72 0.29
73 0.31
74 0.31
75 0.31
76 0.32
77 0.3
78 0.28
79 0.25
80 0.2
81 0.17
82 0.18
83 0.16
84 0.18
85 0.21
86 0.23
87 0.23
88 0.25
89 0.29
90 0.34
91 0.43
92 0.49
93 0.54
94 0.63
95 0.69
96 0.76
97 0.75
98 0.68
99 0.64
100 0.63
101 0.58
102 0.51
103 0.42
104 0.32
105 0.3
106 0.27
107 0.23
108 0.14
109 0.11
110 0.09
111 0.09
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.07
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.09
127 0.11
128 0.14
129 0.18
130 0.23
131 0.27
132 0.31
133 0.38
134 0.4
135 0.47
136 0.47
137 0.47
138 0.49
139 0.5
140 0.46
141 0.4
142 0.35
143 0.26
144 0.25
145 0.25
146 0.25
147 0.27
148 0.32
149 0.39
150 0.4
151 0.4
152 0.39
153 0.36
154 0.32
155 0.29
156 0.24
157 0.16
158 0.15
159 0.15
160 0.14
161 0.12
162 0.11
163 0.08
164 0.07
165 0.06
166 0.05
167 0.05
168 0.05
169 0.04
170 0.05
171 0.04
172 0.05
173 0.05
174 0.06
175 0.07
176 0.08
177 0.09
178 0.1
179 0.15
180 0.2
181 0.24
182 0.28
183 0.34
184 0.41
185 0.48
186 0.55
187 0.56
188 0.56
189 0.55
190 0.53
191 0.5
192 0.43
193 0.36
194 0.29
195 0.24
196 0.18
197 0.15
198 0.13
199 0.11
200 0.09
201 0.09
202 0.08
203 0.08
204 0.09
205 0.13
206 0.12
207 0.13
208 0.18
209 0.21
210 0.29
211 0.33
212 0.36
213 0.35
214 0.37
215 0.36
216 0.32
217 0.3
218 0.22
219 0.17
220 0.13
221 0.11
222 0.08
223 0.09
224 0.1
225 0.09
226 0.09
227 0.09
228 0.09
229 0.11
230 0.1
231 0.1
232 0.09
233 0.09
234 0.08
235 0.09
236 0.09
237 0.07
238 0.1
239 0.13
240 0.17
241 0.2
242 0.22
243 0.29
244 0.34
245 0.42
246 0.46
247 0.51
248 0.52
249 0.53
250 0.55
251 0.5
252 0.46
253 0.39
254 0.33
255 0.24
256 0.21
257 0.19
258 0.16
259 0.16
260 0.14
261 0.14
262 0.13
263 0.13
264 0.14
265 0.12
266 0.15
267 0.16
268 0.2
269 0.2
270 0.2
271 0.24
272 0.24
273 0.3
274 0.35
275 0.37
276 0.4
277 0.43
278 0.44
279 0.45
280 0.49
281 0.47
282 0.44
283 0.44
284 0.43
285 0.41
286 0.39
287 0.36
288 0.3
289 0.27
290 0.26
291 0.24
292 0.24
293 0.28
294 0.33
295 0.41
296 0.49
297 0.57
298 0.63
299 0.7
300 0.7
301 0.75
302 0.8
303 0.82
304 0.82
305 0.83
306 0.82
307 0.81
308 0.86
309 0.83
310 0.81
311 0.81
312 0.79
313 0.74
314 0.74
315 0.74
316 0.74
317 0.75
318 0.78
319 0.78
320 0.79
321 0.76
322 0.78
323 0.74
324 0.73
325 0.67
326 0.63
327 0.55
328 0.51
329 0.49
330 0.4
331 0.34
332 0.24
333 0.2
334 0.14