Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8SBW0

Protein Details
Accession A0A3D8SBW0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-71GYVGRRRRTGTRMKHRSRPVYBasic
NLS Segment(s)
PositionSequence
56-65RRRTGTRMKH
Subcellular Location(s) plas 10, mito 5, extr 5, vacu 4, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAVFSCIRDLFRSIGACIMGVVNAIASGIKVVINGIVSVLGVLVSCLTCGYVGRRRRTGTRMKHRSRPVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.18
4 0.16
5 0.14
6 0.12
7 0.08
8 0.06
9 0.06
10 0.04
11 0.03
12 0.03
13 0.03
14 0.02
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.04
22 0.04
23 0.04
24 0.03
25 0.03
26 0.03
27 0.03
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.05
38 0.1
39 0.18
40 0.26
41 0.33
42 0.39
43 0.43
44 0.5
45 0.57
46 0.62
47 0.65
48 0.69
49 0.74
50 0.76
51 0.82