Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8R4L8

Protein Details
Accession A0A3D8R4L8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-85AYHRQLRHRLHNRPRPSSERBasic
NLS Segment(s)
Subcellular Location(s) extr 19, mito 3, plas 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGLNRDVAISLYFAILGSAIFLGTSIFLAGGYKHIVAFILTRRHPRGRRNADPDLESNAVKLQGLAYHRQLRHRLHNRPRPSSERFPSHEERTSAQLYDSYLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.05
4 0.04
5 0.04
6 0.04
7 0.03
8 0.03
9 0.03
10 0.04
11 0.04
12 0.03
13 0.03
14 0.03
15 0.04
16 0.04
17 0.05
18 0.06
19 0.07
20 0.06
21 0.06
22 0.07
23 0.07
24 0.08
25 0.12
26 0.17
27 0.19
28 0.24
29 0.29
30 0.37
31 0.42
32 0.48
33 0.55
34 0.58
35 0.64
36 0.67
37 0.68
38 0.62
39 0.59
40 0.52
41 0.46
42 0.38
43 0.29
44 0.21
45 0.16
46 0.14
47 0.12
48 0.11
49 0.06
50 0.07
51 0.1
52 0.13
53 0.17
54 0.25
55 0.27
56 0.32
57 0.39
58 0.42
59 0.51
60 0.57
61 0.63
62 0.66
63 0.74
64 0.78
65 0.79
66 0.81
67 0.77
68 0.76
69 0.75
70 0.73
71 0.71
72 0.67
73 0.66
74 0.66
75 0.65
76 0.63
77 0.56
78 0.5
79 0.48
80 0.46
81 0.39
82 0.32
83 0.28