Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8R9M0

Protein Details
Accession A0A3D8R9M0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
71-97ASPPPTEKSQRKNNKRFPKKYRDDGQIHydrophilic
NLS Segment(s)
PositionSequence
84-86NKR
Subcellular Location(s) nucl 13, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016191  Ribonuclease/ribotoxin  
Gene Ontology GO:0003723  F:RNA binding  
GO:0004540  F:RNA nuclease activity  
Amino Acid Sequences MCFSDRSQKKSETPLAPAPAPAPTPVPVPVPVPTPTKQVPVAYRIDRGRDEFDPSPYHIRTRSSIQRHLDASPPPTEKSQRKNNKRFPKKYRDDGQINPKLFKQGSYYEYPTMSWPYNSQNAKGQGYRMVNGVRDEVEVGFTRTITDRNKNIQGVIYHPKWSRRGFVRAETMYSAGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.53
4 0.48
5 0.4
6 0.33
7 0.3
8 0.24
9 0.19
10 0.15
11 0.17
12 0.17
13 0.19
14 0.17
15 0.18
16 0.19
17 0.2
18 0.22
19 0.25
20 0.24
21 0.28
22 0.28
23 0.3
24 0.31
25 0.32
26 0.32
27 0.32
28 0.37
29 0.33
30 0.38
31 0.36
32 0.38
33 0.35
34 0.35
35 0.35
36 0.3
37 0.34
38 0.3
39 0.31
40 0.3
41 0.3
42 0.33
43 0.3
44 0.31
45 0.26
46 0.27
47 0.27
48 0.31
49 0.38
50 0.38
51 0.45
52 0.45
53 0.47
54 0.47
55 0.45
56 0.42
57 0.35
58 0.31
59 0.29
60 0.28
61 0.25
62 0.26
63 0.31
64 0.33
65 0.39
66 0.46
67 0.52
68 0.61
69 0.71
70 0.78
71 0.82
72 0.87
73 0.89
74 0.88
75 0.89
76 0.85
77 0.84
78 0.81
79 0.78
80 0.72
81 0.69
82 0.69
83 0.66
84 0.59
85 0.51
86 0.44
87 0.4
88 0.34
89 0.29
90 0.22
91 0.19
92 0.22
93 0.26
94 0.28
95 0.26
96 0.26
97 0.26
98 0.23
99 0.22
100 0.19
101 0.15
102 0.15
103 0.17
104 0.24
105 0.25
106 0.25
107 0.29
108 0.32
109 0.35
110 0.34
111 0.31
112 0.3
113 0.31
114 0.3
115 0.26
116 0.23
117 0.22
118 0.22
119 0.23
120 0.17
121 0.15
122 0.15
123 0.12
124 0.13
125 0.12
126 0.13
127 0.12
128 0.11
129 0.12
130 0.12
131 0.17
132 0.21
133 0.27
134 0.31
135 0.38
136 0.44
137 0.44
138 0.44
139 0.43
140 0.39
141 0.37
142 0.4
143 0.36
144 0.37
145 0.39
146 0.45
147 0.47
148 0.49
149 0.52
150 0.5
151 0.56
152 0.55
153 0.59
154 0.62
155 0.57
156 0.57
157 0.51
158 0.45