Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NE50

Protein Details
Accession B8NE50    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
138-157LEKARRNPKLMERLRRQGKLBasic
NLS Segment(s)
PositionSequence
129-157RREEARQKMLEKARRNPKLMERLRRQGKL
Subcellular Location(s) nucl 19, cyto 3, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011058  Cyanovirin-N  
IPR036673  Cyanovirin-N_sf  
Pfam View protein in Pfam  
PF08881  CVNH  
Amino Acid Sequences MNIATTCNSWSIENHRLEEERRWVTDLHCKAKKDNGEWISTQLRLDDILGNDDGNFKYSLRYPERNISSSMSNPRLEVTGDGRPILHGRLTTRDAYGHDRSLDLSKILWNKDGRLSLNEDVVRAEDDRRREEARQKMLEKARRNPKLMERLRRQGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.38
4 0.4
5 0.43
6 0.44
7 0.4
8 0.38
9 0.37
10 0.35
11 0.35
12 0.42
13 0.43
14 0.44
15 0.45
16 0.45
17 0.47
18 0.53
19 0.57
20 0.5
21 0.52
22 0.46
23 0.44
24 0.43
25 0.45
26 0.4
27 0.34
28 0.31
29 0.21
30 0.18
31 0.14
32 0.15
33 0.13
34 0.1
35 0.12
36 0.12
37 0.11
38 0.11
39 0.13
40 0.12
41 0.1
42 0.11
43 0.08
44 0.1
45 0.13
46 0.2
47 0.24
48 0.29
49 0.3
50 0.38
51 0.42
52 0.42
53 0.4
54 0.35
55 0.31
56 0.3
57 0.33
58 0.28
59 0.25
60 0.23
61 0.22
62 0.2
63 0.19
64 0.16
65 0.14
66 0.13
67 0.13
68 0.13
69 0.12
70 0.12
71 0.13
72 0.12
73 0.1
74 0.08
75 0.09
76 0.13
77 0.16
78 0.16
79 0.16
80 0.17
81 0.18
82 0.23
83 0.25
84 0.22
85 0.2
86 0.19
87 0.2
88 0.21
89 0.19
90 0.13
91 0.11
92 0.14
93 0.17
94 0.18
95 0.22
96 0.21
97 0.22
98 0.26
99 0.29
100 0.27
101 0.25
102 0.3
103 0.26
104 0.31
105 0.3
106 0.25
107 0.22
108 0.21
109 0.2
110 0.16
111 0.18
112 0.16
113 0.21
114 0.24
115 0.28
116 0.31
117 0.35
118 0.43
119 0.49
120 0.54
121 0.58
122 0.57
123 0.61
124 0.67
125 0.7
126 0.7
127 0.7
128 0.72
129 0.71
130 0.73
131 0.71
132 0.72
133 0.74
134 0.76
135 0.76
136 0.75
137 0.78