Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8SKG3

Protein Details
Accession A0A3D8SKG3   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
91-115TNPNPGQAIRHRKKRRPTSEDISELHydrophilic
NLS Segment(s)
PositionSequence
100-106RHRKKRR
Subcellular Location(s) mito 16, nucl 9
Family & Domain DBs
Amino Acid Sequences MEPLHSRIPYAQWRLQAFRLLSVSSASSRSTFLCRRAHSSSKNENAQADQGTPTIEKNSIKPDITSNQSDAAGSKSTIPPSQLLPQSPLITNPNPGQAIRHRKKRRPTSEDISELSKNPWAVALSSPIRMCNVTGVRLPKALLSDWGLVEQPAPEPESKPTTAADSASNPEQTPQPDRTPRSEVVKGQGNGTPDKNKLWLLPVSLLQDSVVRNEKDKDRPFLKFRMLERKHHLDTITQAAKRSRSQNSVLANLLPHRLKSPLGPLTSALQKLLVWRSDMPDFVLAAKRREAAKYLKRVSDRLRRNNAPGTIWASFDIQKPYSEETLLEGVGTAGLAGQETYGQLKSGAFLVLGDGSDGNAGAVNEAPAFPELVALPGGNGKVPVFDLTRLLSQVELEELRAYHEHFQKSGAFLKPSEKSSIDVLLALWNLQSYVRKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.54
4 0.45
5 0.42
6 0.4
7 0.33
8 0.29
9 0.26
10 0.25
11 0.2
12 0.21
13 0.17
14 0.16
15 0.17
16 0.19
17 0.25
18 0.28
19 0.34
20 0.4
21 0.43
22 0.49
23 0.55
24 0.62
25 0.62
26 0.67
27 0.7
28 0.71
29 0.74
30 0.7
31 0.64
32 0.58
33 0.53
34 0.45
35 0.37
36 0.29
37 0.22
38 0.21
39 0.19
40 0.18
41 0.17
42 0.19
43 0.19
44 0.21
45 0.28
46 0.31
47 0.31
48 0.31
49 0.35
50 0.37
51 0.41
52 0.41
53 0.36
54 0.33
55 0.32
56 0.31
57 0.26
58 0.22
59 0.18
60 0.15
61 0.17
62 0.18
63 0.2
64 0.22
65 0.23
66 0.22
67 0.23
68 0.3
69 0.31
70 0.29
71 0.3
72 0.32
73 0.33
74 0.32
75 0.32
76 0.3
77 0.27
78 0.29
79 0.27
80 0.28
81 0.27
82 0.26
83 0.28
84 0.31
85 0.42
86 0.47
87 0.56
88 0.61
89 0.69
90 0.79
91 0.86
92 0.88
93 0.85
94 0.85
95 0.83
96 0.82
97 0.78
98 0.7
99 0.63
100 0.54
101 0.46
102 0.39
103 0.32
104 0.23
105 0.18
106 0.18
107 0.13
108 0.13
109 0.13
110 0.18
111 0.17
112 0.2
113 0.2
114 0.19
115 0.19
116 0.19
117 0.18
118 0.18
119 0.18
120 0.17
121 0.21
122 0.23
123 0.24
124 0.24
125 0.24
126 0.19
127 0.19
128 0.17
129 0.15
130 0.15
131 0.16
132 0.15
133 0.15
134 0.14
135 0.12
136 0.12
137 0.11
138 0.08
139 0.07
140 0.09
141 0.09
142 0.1
143 0.13
144 0.17
145 0.17
146 0.18
147 0.17
148 0.18
149 0.19
150 0.18
151 0.17
152 0.15
153 0.16
154 0.17
155 0.18
156 0.15
157 0.15
158 0.16
159 0.17
160 0.2
161 0.21
162 0.26
163 0.32
164 0.35
165 0.39
166 0.42
167 0.43
168 0.44
169 0.44
170 0.39
171 0.37
172 0.42
173 0.37
174 0.33
175 0.32
176 0.28
177 0.26
178 0.27
179 0.26
180 0.2
181 0.2
182 0.2
183 0.19
184 0.18
185 0.19
186 0.18
187 0.15
188 0.16
189 0.16
190 0.17
191 0.16
192 0.15
193 0.12
194 0.13
195 0.12
196 0.13
197 0.16
198 0.14
199 0.16
200 0.19
201 0.24
202 0.3
203 0.34
204 0.37
205 0.36
206 0.41
207 0.43
208 0.44
209 0.45
210 0.42
211 0.43
212 0.48
213 0.47
214 0.49
215 0.52
216 0.54
217 0.5
218 0.47
219 0.43
220 0.33
221 0.32
222 0.33
223 0.32
224 0.25
225 0.26
226 0.26
227 0.29
228 0.31
229 0.35
230 0.32
231 0.31
232 0.34
233 0.37
234 0.38
235 0.37
236 0.34
237 0.28
238 0.25
239 0.21
240 0.22
241 0.16
242 0.14
243 0.13
244 0.13
245 0.13
246 0.14
247 0.2
248 0.21
249 0.22
250 0.22
251 0.22
252 0.23
253 0.26
254 0.25
255 0.18
256 0.13
257 0.13
258 0.15
259 0.17
260 0.16
261 0.14
262 0.15
263 0.18
264 0.18
265 0.18
266 0.16
267 0.14
268 0.13
269 0.13
270 0.19
271 0.18
272 0.19
273 0.2
274 0.22
275 0.22
276 0.23
277 0.25
278 0.29
279 0.35
280 0.43
281 0.47
282 0.5
283 0.51
284 0.55
285 0.6
286 0.6
287 0.62
288 0.63
289 0.67
290 0.65
291 0.68
292 0.69
293 0.63
294 0.55
295 0.47
296 0.42
297 0.34
298 0.31
299 0.26
300 0.22
301 0.21
302 0.23
303 0.24
304 0.19
305 0.2
306 0.21
307 0.24
308 0.23
309 0.21
310 0.18
311 0.17
312 0.17
313 0.16
314 0.13
315 0.1
316 0.09
317 0.08
318 0.07
319 0.04
320 0.03
321 0.03
322 0.03
323 0.03
324 0.03
325 0.03
326 0.04
327 0.06
328 0.06
329 0.07
330 0.08
331 0.08
332 0.08
333 0.09
334 0.09
335 0.07
336 0.07
337 0.08
338 0.07
339 0.07
340 0.07
341 0.06
342 0.06
343 0.06
344 0.06
345 0.05
346 0.05
347 0.05
348 0.05
349 0.06
350 0.06
351 0.07
352 0.07
353 0.08
354 0.07
355 0.08
356 0.07
357 0.08
358 0.07
359 0.08
360 0.09
361 0.07
362 0.07
363 0.09
364 0.1
365 0.09
366 0.1
367 0.09
368 0.09
369 0.1
370 0.13
371 0.13
372 0.14
373 0.15
374 0.17
375 0.19
376 0.19
377 0.18
378 0.16
379 0.14
380 0.14
381 0.15
382 0.13
383 0.12
384 0.13
385 0.12
386 0.15
387 0.16
388 0.18
389 0.22
390 0.29
391 0.31
392 0.3
393 0.33
394 0.32
395 0.35
396 0.39
397 0.37
398 0.33
399 0.32
400 0.39
401 0.41
402 0.41
403 0.43
404 0.37
405 0.34
406 0.34
407 0.36
408 0.29
409 0.25
410 0.22
411 0.2
412 0.19
413 0.17
414 0.14
415 0.11
416 0.1
417 0.12
418 0.16