Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MYI0

Protein Details
Accession B8MYI0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
99-121APDSSPTKPKRGRPAKRGAKGSPBasic
NLS Segment(s)
PositionSequence
106-126KPKRGRPAKRGAKGSPSKKAK
Subcellular Location(s) nucl 12.5, cyto_nucl 9, mito 5, cyto 4.5, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MPINWTDPQADAKLLVGIITLHNVKLDYKALAEYMGQGVLYVSTRQRTQELSQTAGCTSSAIQHRVQRIKEKFRIDPPAEGTATGTSPGSAPQPDEGSAPDSSPTKPKRGRPAKRGAKGSPSKKAKASVEHDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.09
4 0.08
5 0.07
6 0.1
7 0.1
8 0.09
9 0.1
10 0.11
11 0.11
12 0.13
13 0.14
14 0.12
15 0.12
16 0.12
17 0.12
18 0.12
19 0.11
20 0.1
21 0.09
22 0.08
23 0.07
24 0.06
25 0.06
26 0.06
27 0.07
28 0.07
29 0.08
30 0.1
31 0.11
32 0.12
33 0.14
34 0.17
35 0.19
36 0.25
37 0.26
38 0.27
39 0.27
40 0.26
41 0.25
42 0.22
43 0.19
44 0.12
45 0.1
46 0.12
47 0.14
48 0.16
49 0.18
50 0.21
51 0.27
52 0.32
53 0.33
54 0.37
55 0.4
56 0.47
57 0.51
58 0.52
59 0.5
60 0.51
61 0.58
62 0.5
63 0.47
64 0.42
65 0.39
66 0.35
67 0.31
68 0.26
69 0.18
70 0.17
71 0.14
72 0.1
73 0.06
74 0.06
75 0.07
76 0.08
77 0.08
78 0.08
79 0.1
80 0.11
81 0.12
82 0.12
83 0.13
84 0.14
85 0.14
86 0.13
87 0.13
88 0.13
89 0.14
90 0.23
91 0.25
92 0.32
93 0.38
94 0.46
95 0.55
96 0.65
97 0.74
98 0.75
99 0.83
100 0.84
101 0.86
102 0.86
103 0.8
104 0.79
105 0.79
106 0.77
107 0.77
108 0.74
109 0.7
110 0.67
111 0.7
112 0.65
113 0.64
114 0.63