Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8RRP1

Protein Details
Accession A0A3D8RRP1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-40LWKIPWRISQPQKARQRKRLRAVDKVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, mito_nucl 13.833, cyto_mito 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MMFKPSSPLFSGLLWKIPWRISQPQKARQRKRLRAVDKVVDTVSAALARNGQSTKAVDRWFKEMPREEEMLPRDKYTIFDKKEKTYRKGIHSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.24
4 0.25
5 0.27
6 0.27
7 0.36
8 0.4
9 0.5
10 0.57
11 0.63
12 0.72
13 0.79
14 0.83
15 0.83
16 0.86
17 0.86
18 0.87
19 0.88
20 0.83
21 0.82
22 0.78
23 0.75
24 0.65
25 0.57
26 0.47
27 0.36
28 0.3
29 0.21
30 0.15
31 0.09
32 0.07
33 0.05
34 0.07
35 0.07
36 0.09
37 0.09
38 0.09
39 0.09
40 0.11
41 0.13
42 0.16
43 0.19
44 0.21
45 0.22
46 0.27
47 0.3
48 0.31
49 0.35
50 0.38
51 0.39
52 0.41
53 0.42
54 0.37
55 0.4
56 0.41
57 0.41
58 0.35
59 0.31
60 0.28
61 0.26
62 0.28
63 0.29
64 0.35
65 0.34
66 0.41
67 0.46
68 0.53
69 0.63
70 0.69
71 0.67
72 0.68
73 0.7