Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8RYN1

Protein Details
Accession A0A3D8RYN1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
359-383HFFVHAFKWWKRRIERRREWEESAEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, E.R. 4, vacu 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038770  Na+/solute_symporter_sf  
IPR016833  Put_Na-Bile_cotransptr  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13593  SBF_like  
Amino Acid Sequences MSTPQPTWKRIALFVLHQWLIIGIGVACLLGYFFPNVAKHGGIIRSEYSILYGAVAVVFLISGLSIPQDKLLRQLFNWRLHVLVQVTSFLFIPALVLAVVHAILAGDKAGRVDRGVLAGYIFTACIPTTIASNVVMTRSAGGDDAAALAEVLIANILGPFVTAGWTVTLLPASEEFDVWRDQNEDLTAMYRDVFKQLGLAVLLPLAVGQVIRFLWPKKTGHIIQKYRIAKLGSFCLLLMIWSTFSSCFATGALQGLSTESIIFVVLFNIALYMFLTAVCFSISRPPQSLCSRTTFGGWQILRQMPAEETIAVCFCGPAKSTALGIPLLYAMWTPVDLYIKAKTSVPVLLYTTEQLFVAHFFVHAFKWWKRRIERRREWEESAESGGAEPPSASLSEVTEEVKAAEFGQPKPRGLPATQCVDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.41
4 0.37
5 0.34
6 0.28
7 0.24
8 0.19
9 0.13
10 0.06
11 0.05
12 0.05
13 0.05
14 0.05
15 0.04
16 0.04
17 0.04
18 0.05
19 0.06
20 0.06
21 0.1
22 0.12
23 0.14
24 0.16
25 0.16
26 0.16
27 0.2
28 0.23
29 0.2
30 0.23
31 0.22
32 0.22
33 0.23
34 0.21
35 0.18
36 0.16
37 0.14
38 0.12
39 0.1
40 0.08
41 0.07
42 0.07
43 0.05
44 0.04
45 0.03
46 0.03
47 0.03
48 0.02
49 0.02
50 0.03
51 0.04
52 0.06
53 0.06
54 0.1
55 0.13
56 0.13
57 0.21
58 0.26
59 0.27
60 0.26
61 0.37
62 0.41
63 0.46
64 0.49
65 0.42
66 0.38
67 0.37
68 0.4
69 0.31
70 0.26
71 0.19
72 0.17
73 0.17
74 0.17
75 0.16
76 0.12
77 0.1
78 0.07
79 0.07
80 0.05
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.04
93 0.03
94 0.04
95 0.05
96 0.06
97 0.07
98 0.07
99 0.09
100 0.09
101 0.1
102 0.11
103 0.1
104 0.09
105 0.08
106 0.08
107 0.07
108 0.06
109 0.04
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.07
116 0.07
117 0.08
118 0.08
119 0.09
120 0.09
121 0.09
122 0.09
123 0.08
124 0.08
125 0.07
126 0.07
127 0.06
128 0.06
129 0.05
130 0.05
131 0.05
132 0.04
133 0.04
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.03
149 0.03
150 0.04
151 0.04
152 0.05
153 0.05
154 0.05
155 0.06
156 0.05
157 0.05
158 0.05
159 0.07
160 0.07
161 0.07
162 0.07
163 0.08
164 0.09
165 0.09
166 0.1
167 0.09
168 0.09
169 0.1
170 0.1
171 0.09
172 0.08
173 0.09
174 0.09
175 0.07
176 0.08
177 0.08
178 0.08
179 0.09
180 0.09
181 0.07
182 0.07
183 0.07
184 0.07
185 0.07
186 0.06
187 0.05
188 0.05
189 0.05
190 0.04
191 0.03
192 0.03
193 0.02
194 0.02
195 0.02
196 0.03
197 0.03
198 0.05
199 0.06
200 0.08
201 0.11
202 0.15
203 0.16
204 0.17
205 0.23
206 0.27
207 0.35
208 0.44
209 0.45
210 0.45
211 0.53
212 0.53
213 0.48
214 0.47
215 0.38
216 0.3
217 0.27
218 0.26
219 0.19
220 0.17
221 0.16
222 0.13
223 0.12
224 0.1
225 0.09
226 0.06
227 0.05
228 0.05
229 0.06
230 0.05
231 0.07
232 0.08
233 0.07
234 0.07
235 0.07
236 0.07
237 0.07
238 0.09
239 0.07
240 0.06
241 0.06
242 0.06
243 0.06
244 0.06
245 0.05
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.03
257 0.03
258 0.04
259 0.04
260 0.04
261 0.04
262 0.04
263 0.04
264 0.05
265 0.05
266 0.05
267 0.05
268 0.13
269 0.16
270 0.18
271 0.2
272 0.22
273 0.28
274 0.34
275 0.38
276 0.33
277 0.35
278 0.35
279 0.34
280 0.34
281 0.29
282 0.25
283 0.29
284 0.26
285 0.22
286 0.26
287 0.27
288 0.26
289 0.25
290 0.24
291 0.16
292 0.18
293 0.17
294 0.12
295 0.11
296 0.11
297 0.1
298 0.1
299 0.09
300 0.07
301 0.07
302 0.08
303 0.09
304 0.1
305 0.12
306 0.13
307 0.14
308 0.15
309 0.16
310 0.15
311 0.14
312 0.12
313 0.1
314 0.09
315 0.08
316 0.06
317 0.05
318 0.05
319 0.05
320 0.05
321 0.07
322 0.09
323 0.1
324 0.12
325 0.15
326 0.17
327 0.18
328 0.19
329 0.19
330 0.18
331 0.21
332 0.2
333 0.19
334 0.18
335 0.18
336 0.18
337 0.19
338 0.18
339 0.15
340 0.14
341 0.12
342 0.11
343 0.1
344 0.1
345 0.09
346 0.08
347 0.08
348 0.1
349 0.1
350 0.15
351 0.21
352 0.25
353 0.35
354 0.42
355 0.51
356 0.59
357 0.7
358 0.75
359 0.8
360 0.86
361 0.86
362 0.89
363 0.87
364 0.82
365 0.78
366 0.72
367 0.63
368 0.55
369 0.45
370 0.35
371 0.29
372 0.26
373 0.19
374 0.15
375 0.12
376 0.09
377 0.1
378 0.1
379 0.1
380 0.08
381 0.09
382 0.11
383 0.13
384 0.13
385 0.13
386 0.12
387 0.12
388 0.13
389 0.12
390 0.11
391 0.16
392 0.19
393 0.22
394 0.32
395 0.36
396 0.36
397 0.39
398 0.43
399 0.42
400 0.41
401 0.46
402 0.42