Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8Q7T7

Protein Details
Accession A0A3D8Q7T7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-33ETDRRGRPERPRMASRKPSABasic
NLS Segment(s)
PositionSequence
20-25RPERPR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019357  SCOC  
Pfam View protein in Pfam  
PF10224  DUF2205  
Amino Acid Sequences MSSLSSSSSISDAETDRRGRPERPRMASRKPSASILVPRDHPEIEIEEEEFPPDDARAMSPRRNSADLERLGKEARQTLQEQAKALQSSLQALAERIDAVKTDHDKLENENRFLQDYIGGLTRNMKSEMSRSSTKVKKSHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.26
4 0.33
5 0.36
6 0.41
7 0.49
8 0.55
9 0.6
10 0.65
11 0.72
12 0.72
13 0.79
14 0.82
15 0.78
16 0.75
17 0.67
18 0.61
19 0.54
20 0.51
21 0.48
22 0.42
23 0.4
24 0.35
25 0.36
26 0.35
27 0.33
28 0.28
29 0.22
30 0.2
31 0.19
32 0.18
33 0.16
34 0.14
35 0.14
36 0.14
37 0.13
38 0.11
39 0.08
40 0.07
41 0.07
42 0.06
43 0.07
44 0.11
45 0.14
46 0.18
47 0.2
48 0.24
49 0.27
50 0.28
51 0.29
52 0.28
53 0.32
54 0.31
55 0.31
56 0.28
57 0.27
58 0.25
59 0.24
60 0.22
61 0.17
62 0.15
63 0.15
64 0.15
65 0.2
66 0.25
67 0.25
68 0.25
69 0.24
70 0.26
71 0.23
72 0.22
73 0.18
74 0.13
75 0.13
76 0.13
77 0.13
78 0.1
79 0.1
80 0.11
81 0.09
82 0.09
83 0.07
84 0.07
85 0.06
86 0.07
87 0.12
88 0.14
89 0.17
90 0.18
91 0.2
92 0.21
93 0.26
94 0.35
95 0.36
96 0.36
97 0.37
98 0.37
99 0.37
100 0.37
101 0.31
102 0.22
103 0.17
104 0.16
105 0.15
106 0.14
107 0.12
108 0.17
109 0.18
110 0.19
111 0.2
112 0.2
113 0.2
114 0.24
115 0.3
116 0.31
117 0.34
118 0.35
119 0.43
120 0.48
121 0.54