Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8QS38

Protein Details
Accession A0A3D8QS38    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
399-426SRNDRFTAAQKRTRRRTLIKRAQRLIALHydrophilic
NLS Segment(s)
PositionSequence
413-413R
Subcellular Location(s) extr 15, nucl 5, cyto 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MALILNLLRAEPCVFNAILEKLNFVDLMNFMVSTPATASYIFGWGAKVLISRSNANAWPGHVDFQDGQQVTRWHEVQWARNNAAGAPIPNPIPALPRPLPAQIVMTNLNSVNRPIEWLIRHGHYNILTDLHTNGLWDPLGYEYNGESYLAHAVYHSDRPLRIADLIISLATNNADWRYAIKPYEVNDVRGNGTGATNLALPLSLQLKPHGYELWRRYWNAVTGPNINAATAIPQRYRGELAELIDRAMAESLRDNPGGGLNLAFFNGATTTVWHFAGANYNMDFTEFLHYHTPGSIDQVETIAGLTPVEHCYNFDSDNVAFIPQLLRLGADPGTIPVPEVYLRDLPNPRDKFLHRVLDDIPNPTTPAKISDIVPPYVGEGGSLLHYIIVGLEIKLYALSRNDRFTAAQKRTRRRTLIKRAQRLIALVRKGNSNGAPNPATLDRHNRTALQLAQSHGYHELYYALEVNPAGLARRHRYNLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.19
4 0.2
5 0.22
6 0.22
7 0.22
8 0.18
9 0.19
10 0.19
11 0.15
12 0.15
13 0.1
14 0.13
15 0.12
16 0.11
17 0.1
18 0.11
19 0.11
20 0.09
21 0.1
22 0.09
23 0.09
24 0.09
25 0.11
26 0.1
27 0.13
28 0.12
29 0.12
30 0.11
31 0.1
32 0.1
33 0.1
34 0.11
35 0.1
36 0.15
37 0.18
38 0.19
39 0.22
40 0.26
41 0.27
42 0.28
43 0.28
44 0.25
45 0.27
46 0.26
47 0.27
48 0.22
49 0.24
50 0.21
51 0.22
52 0.29
53 0.23
54 0.23
55 0.24
56 0.27
57 0.27
58 0.32
59 0.31
60 0.23
61 0.3
62 0.35
63 0.39
64 0.46
65 0.49
66 0.45
67 0.46
68 0.46
69 0.39
70 0.37
71 0.3
72 0.22
73 0.17
74 0.17
75 0.16
76 0.15
77 0.16
78 0.13
79 0.16
80 0.16
81 0.23
82 0.22
83 0.24
84 0.27
85 0.28
86 0.29
87 0.25
88 0.27
89 0.2
90 0.22
91 0.22
92 0.2
93 0.19
94 0.19
95 0.19
96 0.17
97 0.16
98 0.15
99 0.12
100 0.14
101 0.14
102 0.18
103 0.18
104 0.21
105 0.24
106 0.24
107 0.26
108 0.24
109 0.27
110 0.23
111 0.24
112 0.21
113 0.19
114 0.17
115 0.16
116 0.16
117 0.14
118 0.12
119 0.1
120 0.09
121 0.09
122 0.08
123 0.07
124 0.07
125 0.08
126 0.09
127 0.08
128 0.09
129 0.08
130 0.09
131 0.09
132 0.09
133 0.07
134 0.07
135 0.09
136 0.09
137 0.08
138 0.07
139 0.09
140 0.11
141 0.14
142 0.15
143 0.15
144 0.15
145 0.17
146 0.18
147 0.18
148 0.16
149 0.14
150 0.13
151 0.11
152 0.12
153 0.1
154 0.08
155 0.07
156 0.06
157 0.06
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.08
164 0.1
165 0.12
166 0.13
167 0.14
168 0.16
169 0.17
170 0.28
171 0.26
172 0.28
173 0.27
174 0.28
175 0.27
176 0.25
177 0.24
178 0.14
179 0.13
180 0.1
181 0.08
182 0.07
183 0.06
184 0.06
185 0.05
186 0.04
187 0.04
188 0.05
189 0.07
190 0.08
191 0.08
192 0.1
193 0.12
194 0.13
195 0.14
196 0.14
197 0.14
198 0.2
199 0.23
200 0.3
201 0.31
202 0.31
203 0.32
204 0.32
205 0.33
206 0.28
207 0.28
208 0.23
209 0.22
210 0.22
211 0.22
212 0.2
213 0.18
214 0.15
215 0.11
216 0.12
217 0.11
218 0.13
219 0.1
220 0.14
221 0.15
222 0.15
223 0.17
224 0.14
225 0.15
226 0.14
227 0.15
228 0.15
229 0.14
230 0.13
231 0.12
232 0.12
233 0.09
234 0.08
235 0.06
236 0.04
237 0.05
238 0.07
239 0.09
240 0.09
241 0.09
242 0.09
243 0.1
244 0.1
245 0.09
246 0.07
247 0.06
248 0.06
249 0.06
250 0.06
251 0.04
252 0.04
253 0.04
254 0.05
255 0.04
256 0.05
257 0.07
258 0.08
259 0.08
260 0.08
261 0.08
262 0.08
263 0.14
264 0.14
265 0.14
266 0.13
267 0.13
268 0.13
269 0.13
270 0.13
271 0.08
272 0.12
273 0.1
274 0.12
275 0.14
276 0.14
277 0.14
278 0.15
279 0.15
280 0.1
281 0.14
282 0.13
283 0.11
284 0.1
285 0.1
286 0.1
287 0.08
288 0.08
289 0.05
290 0.05
291 0.04
292 0.04
293 0.05
294 0.07
295 0.09
296 0.08
297 0.09
298 0.11
299 0.13
300 0.13
301 0.13
302 0.13
303 0.12
304 0.14
305 0.13
306 0.11
307 0.1
308 0.09
309 0.1
310 0.07
311 0.08
312 0.06
313 0.06
314 0.06
315 0.08
316 0.08
317 0.07
318 0.07
319 0.07
320 0.08
321 0.08
322 0.08
323 0.06
324 0.07
325 0.08
326 0.09
327 0.11
328 0.14
329 0.15
330 0.2
331 0.25
332 0.28
333 0.37
334 0.39
335 0.38
336 0.4
337 0.41
338 0.42
339 0.45
340 0.5
341 0.4
342 0.41
343 0.42
344 0.45
345 0.45
346 0.41
347 0.35
348 0.26
349 0.27
350 0.25
351 0.23
352 0.15
353 0.17
354 0.17
355 0.18
356 0.19
357 0.24
358 0.28
359 0.27
360 0.27
361 0.24
362 0.21
363 0.2
364 0.18
365 0.11
366 0.08
367 0.07
368 0.08
369 0.08
370 0.07
371 0.05
372 0.05
373 0.05
374 0.05
375 0.05
376 0.05
377 0.05
378 0.05
379 0.05
380 0.06
381 0.06
382 0.07
383 0.08
384 0.12
385 0.18
386 0.21
387 0.25
388 0.26
389 0.28
390 0.3
391 0.35
392 0.42
393 0.44
394 0.5
395 0.56
396 0.65
397 0.73
398 0.8
399 0.81
400 0.81
401 0.83
402 0.86
403 0.88
404 0.88
405 0.89
406 0.85
407 0.8
408 0.72
409 0.65
410 0.62
411 0.59
412 0.54
413 0.48
414 0.44
415 0.43
416 0.43
417 0.44
418 0.39
419 0.37
420 0.34
421 0.37
422 0.36
423 0.33
424 0.36
425 0.34
426 0.33
427 0.31
428 0.38
429 0.36
430 0.4
431 0.43
432 0.4
433 0.4
434 0.43
435 0.43
436 0.39
437 0.39
438 0.35
439 0.37
440 0.36
441 0.35
442 0.31
443 0.27
444 0.21
445 0.18
446 0.18
447 0.13
448 0.15
449 0.15
450 0.12
451 0.13
452 0.13
453 0.13
454 0.12
455 0.12
456 0.12
457 0.14
458 0.21
459 0.26
460 0.34