Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8QKY9

Protein Details
Accession A0A3D8QKY9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-50REGAAVKINRPRRRRRNPSTYHHGFIHydrophilic
NLS Segment(s)
PositionSequence
31-40KINRPRRRRR
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSERGKAGNQPDYGAPVVTIVGRTREGAAVKINRPRRRRRNPSTYHHGFIPQPLARVAQCKPVSGARMHLSPLSHVSGATACNLQTHGTLTTPVYLPIVTLTRLFTRMVAGSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.2
3 0.13
4 0.13
5 0.11
6 0.11
7 0.09
8 0.1
9 0.11
10 0.12
11 0.13
12 0.15
13 0.15
14 0.16
15 0.21
16 0.24
17 0.28
18 0.36
19 0.44
20 0.49
21 0.57
22 0.67
23 0.71
24 0.77
25 0.83
26 0.85
27 0.87
28 0.88
29 0.88
30 0.87
31 0.81
32 0.72
33 0.61
34 0.54
35 0.43
36 0.36
37 0.33
38 0.24
39 0.19
40 0.18
41 0.18
42 0.16
43 0.18
44 0.17
45 0.2
46 0.19
47 0.19
48 0.2
49 0.21
50 0.23
51 0.21
52 0.24
53 0.17
54 0.18
55 0.18
56 0.18
57 0.16
58 0.15
59 0.17
60 0.15
61 0.13
62 0.12
63 0.12
64 0.11
65 0.11
66 0.12
67 0.1
68 0.08
69 0.08
70 0.09
71 0.09
72 0.09
73 0.11
74 0.1
75 0.1
76 0.12
77 0.12
78 0.13
79 0.13
80 0.13
81 0.12
82 0.11
83 0.1
84 0.11
85 0.13
86 0.11
87 0.12
88 0.14
89 0.16
90 0.17
91 0.18
92 0.16
93 0.17