Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NQN2

Protein Details
Accession B8NQN2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAYNPQRAPPRAPRRRRPPQPPRYPGSHIHydrophilic
NLS Segment(s)
PositionSequence
8-21APPRAPRRRRPPQP
Subcellular Location(s) nucl 13, cyto 7, mito 6
Family & Domain DBs
Amino Acid Sequences MAYNPQRAPPRAPRRRRPPQPPRYPGSHIVTLFTGNQELWFVQVKLDPGVVPSFEEYENAVKQGKAELTLQDNRKKDKEGQMPPPDGIEKLLDGIGEARLKSQRLPHIQPALCPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.9
3 0.93
4 0.93
5 0.93
6 0.93
7 0.94
8 0.91
9 0.85
10 0.81
11 0.76
12 0.72
13 0.67
14 0.61
15 0.5
16 0.44
17 0.39
18 0.33
19 0.28
20 0.21
21 0.16
22 0.1
23 0.1
24 0.09
25 0.08
26 0.08
27 0.1
28 0.09
29 0.09
30 0.1
31 0.11
32 0.11
33 0.11
34 0.09
35 0.08
36 0.09
37 0.08
38 0.07
39 0.07
40 0.08
41 0.08
42 0.08
43 0.08
44 0.1
45 0.1
46 0.1
47 0.1
48 0.09
49 0.09
50 0.1
51 0.1
52 0.09
53 0.1
54 0.11
55 0.15
56 0.21
57 0.27
58 0.31
59 0.34
60 0.37
61 0.38
62 0.4
63 0.41
64 0.45
65 0.5
66 0.51
67 0.58
68 0.62
69 0.62
70 0.59
71 0.55
72 0.46
73 0.37
74 0.3
75 0.21
76 0.13
77 0.12
78 0.11
79 0.09
80 0.08
81 0.09
82 0.11
83 0.11
84 0.11
85 0.13
86 0.16
87 0.18
88 0.21
89 0.27
90 0.33
91 0.4
92 0.47
93 0.53
94 0.59
95 0.59