Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8SE18

Protein Details
Accession A0A3D8SE18    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
215-237REIRRVRRQMQAARRQKRRNEADBasic
NLS Segment(s)
PositionSequence
179-183RKKKR
217-232IRRVRRQMQAARRQKR
Subcellular Location(s) cyto 14, nucl 7, mito 4
Family & Domain DBs
Amino Acid Sequences MAIKSIEFIEDLTPRDAKLLAQLLSLREELPHKSWLAYQAACIRDLPAQLRRPSTILRRITRALDPFRPQQACLCKAHKRLNAHLIHRLFLRLAAEVTTRIATLRSNPYLPEEVRLFVTRLEGVNNLWMKPEVYKAIFSALPEGTCFVEVPSGCEACILSVVGGSHRAVTDFRASIHGRKKKRGTEAKLLVLVDAWTELSKDGEVIKAESERLGREIRRVRRQMQAARRQKRRNEADVVVGEGMGSSGGSGAVAEEAEVNEGSERSEGGEHDFEGSIIDFYASRMSVTGRGKSTHLTGVMHPDFGMNVIFDPVSATSQRRLNSQNSSTVYSESNYSTPTMEASLSDPSLSAER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.17
5 0.21
6 0.23
7 0.21
8 0.22
9 0.25
10 0.25
11 0.27
12 0.28
13 0.21
14 0.18
15 0.2
16 0.22
17 0.23
18 0.25
19 0.23
20 0.24
21 0.26
22 0.29
23 0.32
24 0.28
25 0.29
26 0.32
27 0.32
28 0.32
29 0.3
30 0.26
31 0.23
32 0.25
33 0.26
34 0.28
35 0.34
36 0.38
37 0.41
38 0.41
39 0.41
40 0.45
41 0.49
42 0.5
43 0.51
44 0.51
45 0.54
46 0.55
47 0.56
48 0.55
49 0.54
50 0.52
51 0.5
52 0.51
53 0.51
54 0.57
55 0.54
56 0.49
57 0.48
58 0.5
59 0.47
60 0.48
61 0.49
62 0.49
63 0.55
64 0.64
65 0.63
66 0.61
67 0.64
68 0.67
69 0.67
70 0.63
71 0.64
72 0.55
73 0.51
74 0.45
75 0.39
76 0.29
77 0.23
78 0.2
79 0.13
80 0.12
81 0.11
82 0.11
83 0.11
84 0.12
85 0.1
86 0.09
87 0.09
88 0.09
89 0.08
90 0.13
91 0.19
92 0.21
93 0.21
94 0.22
95 0.25
96 0.29
97 0.29
98 0.28
99 0.22
100 0.21
101 0.22
102 0.23
103 0.19
104 0.15
105 0.16
106 0.13
107 0.13
108 0.13
109 0.11
110 0.1
111 0.16
112 0.17
113 0.15
114 0.14
115 0.14
116 0.14
117 0.14
118 0.16
119 0.13
120 0.13
121 0.14
122 0.13
123 0.15
124 0.15
125 0.15
126 0.16
127 0.13
128 0.12
129 0.11
130 0.12
131 0.1
132 0.09
133 0.09
134 0.06
135 0.08
136 0.08
137 0.1
138 0.11
139 0.11
140 0.11
141 0.11
142 0.11
143 0.08
144 0.08
145 0.06
146 0.04
147 0.04
148 0.04
149 0.04
150 0.06
151 0.06
152 0.06
153 0.06
154 0.07
155 0.06
156 0.08
157 0.1
158 0.09
159 0.1
160 0.14
161 0.15
162 0.2
163 0.29
164 0.35
165 0.37
166 0.44
167 0.51
168 0.52
169 0.61
170 0.65
171 0.63
172 0.66
173 0.67
174 0.62
175 0.58
176 0.51
177 0.41
178 0.31
179 0.25
180 0.14
181 0.09
182 0.06
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.05
189 0.05
190 0.06
191 0.07
192 0.07
193 0.08
194 0.08
195 0.09
196 0.1
197 0.1
198 0.09
199 0.11
200 0.15
201 0.14
202 0.21
203 0.3
204 0.37
205 0.46
206 0.5
207 0.52
208 0.56
209 0.63
210 0.64
211 0.66
212 0.69
213 0.69
214 0.74
215 0.8
216 0.81
217 0.79
218 0.81
219 0.78
220 0.74
221 0.7
222 0.62
223 0.58
224 0.51
225 0.46
226 0.35
227 0.27
228 0.2
229 0.13
230 0.12
231 0.05
232 0.04
233 0.02
234 0.02
235 0.02
236 0.02
237 0.02
238 0.03
239 0.03
240 0.03
241 0.03
242 0.04
243 0.04
244 0.05
245 0.05
246 0.05
247 0.06
248 0.06
249 0.06
250 0.06
251 0.06
252 0.06
253 0.07
254 0.08
255 0.11
256 0.12
257 0.12
258 0.14
259 0.14
260 0.13
261 0.12
262 0.12
263 0.08
264 0.07
265 0.07
266 0.06
267 0.06
268 0.08
269 0.07
270 0.07
271 0.08
272 0.09
273 0.16
274 0.19
275 0.24
276 0.25
277 0.26
278 0.28
279 0.3
280 0.31
281 0.28
282 0.27
283 0.24
284 0.23
285 0.31
286 0.3
287 0.28
288 0.25
289 0.21
290 0.19
291 0.18
292 0.17
293 0.07
294 0.07
295 0.08
296 0.07
297 0.07
298 0.09
299 0.09
300 0.11
301 0.13
302 0.15
303 0.19
304 0.24
305 0.25
306 0.29
307 0.34
308 0.37
309 0.44
310 0.46
311 0.49
312 0.48
313 0.51
314 0.47
315 0.44
316 0.39
317 0.31
318 0.3
319 0.24
320 0.22
321 0.19
322 0.19
323 0.17
324 0.16
325 0.16
326 0.15
327 0.13
328 0.12
329 0.13
330 0.16
331 0.16
332 0.15
333 0.14