Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MYS5

Protein Details
Accession B8MYS5    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25KCPAKDQSLRNIQRNRRRLGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 8.5, cyto 8.5, mito 7
Family & Domain DBs
Gene Ontology GO:0005634  C:nucleus  
Amino Acid Sequences MTSQWKCPAKDQSLRNIQRNRRRLGDSGLPATVVRCSKSGATRRNPAVNDASQCSSIVSTVRIGGKDGRHQPKLQSRVLIFELEDKSLSTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.74
3 0.74
4 0.75
5 0.77
6 0.8
7 0.75
8 0.7
9 0.67
10 0.61
11 0.58
12 0.57
13 0.51
14 0.45
15 0.4
16 0.34
17 0.3
18 0.27
19 0.24
20 0.16
21 0.13
22 0.11
23 0.12
24 0.14
25 0.21
26 0.29
27 0.34
28 0.39
29 0.44
30 0.47
31 0.51
32 0.49
33 0.44
34 0.4
35 0.35
36 0.31
37 0.27
38 0.24
39 0.2
40 0.19
41 0.17
42 0.13
43 0.11
44 0.1
45 0.08
46 0.07
47 0.1
48 0.11
49 0.11
50 0.13
51 0.16
52 0.19
53 0.26
54 0.35
55 0.4
56 0.43
57 0.44
58 0.51
59 0.57
60 0.6
61 0.56
62 0.53
63 0.46
64 0.47
65 0.48
66 0.41
67 0.31
68 0.31
69 0.29
70 0.24
71 0.24