Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8RTI8

Protein Details
Accession A0A3D8RTI8   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-35LELFRLEQRYTRRRNRRSTFVSEAHydrophilic
92-117GLDWRQGSPRKQNKKEEGRRSKVSVRHydrophilic
NLS Segment(s)
PositionSequence
98-113GSPRKQNKKEEGRRSK
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 9
Family & Domain DBs
Amino Acid Sequences MVNLIDLINQKLELFRLEQRYTRRRNRRSTFVSEAEYVNGEYIYSPTSSYSAQVTGNSSKSGSSTDTADTSNNAGEPEKKLSRRLSKMAMGGLDWRQGSPRKQNKKEEGRRSKVSVREIHWDGGVRSRDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.26
4 0.29
5 0.34
6 0.42
7 0.51
8 0.59
9 0.66
10 0.71
11 0.73
12 0.81
13 0.84
14 0.85
15 0.82
16 0.81
17 0.78
18 0.7
19 0.65
20 0.56
21 0.48
22 0.39
23 0.32
24 0.24
25 0.16
26 0.12
27 0.08
28 0.07
29 0.06
30 0.07
31 0.06
32 0.06
33 0.06
34 0.08
35 0.08
36 0.09
37 0.09
38 0.09
39 0.1
40 0.1
41 0.13
42 0.14
43 0.14
44 0.14
45 0.13
46 0.12
47 0.12
48 0.12
49 0.11
50 0.09
51 0.09
52 0.1
53 0.11
54 0.11
55 0.11
56 0.1
57 0.1
58 0.09
59 0.08
60 0.08
61 0.07
62 0.08
63 0.1
64 0.16
65 0.2
66 0.22
67 0.26
68 0.34
69 0.42
70 0.46
71 0.48
72 0.47
73 0.46
74 0.47
75 0.43
76 0.36
77 0.28
78 0.25
79 0.22
80 0.2
81 0.17
82 0.15
83 0.17
84 0.21
85 0.26
86 0.34
87 0.43
88 0.51
89 0.6
90 0.7
91 0.77
92 0.83
93 0.89
94 0.89
95 0.9
96 0.87
97 0.85
98 0.81
99 0.78
100 0.74
101 0.71
102 0.67
103 0.6
104 0.6
105 0.57
106 0.52
107 0.47
108 0.43
109 0.36
110 0.37