Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MXD6

Protein Details
Accession B8MXD6    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAIRRAHRKSRHGCTNCKQRRVKCDETRPYCQNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MAIRRAHRKSRHGCTNCKQRRVKCDETRPYCQNCTRRNNTCVYVTPVRVLSEPIASAEAGTSIGCLPIKPEPAVLPYSSWASLTPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.84
4 0.84
5 0.82
6 0.78
7 0.82
8 0.81
9 0.81
10 0.8
11 0.82
12 0.82
13 0.81
14 0.82
15 0.78
16 0.73
17 0.69
18 0.66
19 0.63
20 0.61
21 0.63
22 0.64
23 0.64
24 0.62
25 0.61
26 0.56
27 0.5
28 0.43
29 0.4
30 0.35
31 0.29
32 0.27
33 0.23
34 0.22
35 0.19
36 0.18
37 0.13
38 0.1
39 0.1
40 0.09
41 0.09
42 0.08
43 0.08
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.06
51 0.06
52 0.06
53 0.08
54 0.12
55 0.15
56 0.15
57 0.17
58 0.17
59 0.2
60 0.23
61 0.21
62 0.19
63 0.18
64 0.21
65 0.19
66 0.18