Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MX12

Protein Details
Accession B8MX12   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
107-126QFEKKTVKVWQRKGKFPFLRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 9.166, mito 9, cyto 9, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MPWQAQVCTFCQKQYVHKTGLRDHLSCYTGDVRIPADGIHDVLKIEKILDGGNRRHCQYRCPVCSKTINGRYNFIEHVVYSKHHDVLNGDFQKGTIRRYRHQGWPFQFEKKTVKVWQRKGKFPFLRLPFGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.48
4 0.51
5 0.55
6 0.55
7 0.62
8 0.58
9 0.48
10 0.45
11 0.44
12 0.42
13 0.36
14 0.33
15 0.26
16 0.22
17 0.21
18 0.19
19 0.14
20 0.14
21 0.14
22 0.1
23 0.1
24 0.09
25 0.1
26 0.09
27 0.09
28 0.09
29 0.09
30 0.1
31 0.08
32 0.08
33 0.07
34 0.07
35 0.08
36 0.11
37 0.16
38 0.21
39 0.29
40 0.31
41 0.32
42 0.39
43 0.38
44 0.38
45 0.43
46 0.48
47 0.46
48 0.5
49 0.5
50 0.47
51 0.51
52 0.5
53 0.5
54 0.5
55 0.49
56 0.44
57 0.45
58 0.42
59 0.4
60 0.37
61 0.28
62 0.19
63 0.13
64 0.14
65 0.12
66 0.12
67 0.14
68 0.16
69 0.17
70 0.16
71 0.17
72 0.17
73 0.2
74 0.29
75 0.26
76 0.25
77 0.22
78 0.22
79 0.28
80 0.28
81 0.28
82 0.25
83 0.28
84 0.32
85 0.4
86 0.46
87 0.49
88 0.55
89 0.6
90 0.59
91 0.63
92 0.62
93 0.61
94 0.58
95 0.53
96 0.53
97 0.47
98 0.48
99 0.47
100 0.54
101 0.57
102 0.65
103 0.71
104 0.73
105 0.78
106 0.78
107 0.81
108 0.78
109 0.74
110 0.73
111 0.69