Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8QSM5

Protein Details
Accession A0A3D8QSM5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKRNKKTSQTKFKVRCQRHHydrophilic
NLS Segment(s)
PositionSequence
76-79AKGK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEVSDIKNFIEICRRKDASSARIKRNKKTSQTKFKVRCQRHLYTLVLRDSEKVEKLKQSLPPTLIIAETPKKNAKGKRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.4
3 0.41
4 0.37
5 0.44
6 0.49
7 0.48
8 0.54
9 0.58
10 0.59
11 0.67
12 0.71
13 0.72
14 0.76
15 0.76
16 0.75
17 0.77
18 0.78
19 0.8
20 0.83
21 0.86
22 0.83
23 0.83
24 0.84
25 0.77
26 0.76
27 0.72
28 0.67
29 0.61
30 0.58
31 0.52
32 0.46
33 0.47
34 0.39
35 0.33
36 0.29
37 0.26
38 0.24
39 0.24
40 0.22
41 0.2
42 0.21
43 0.24
44 0.27
45 0.31
46 0.35
47 0.37
48 0.39
49 0.38
50 0.37
51 0.35
52 0.32
53 0.28
54 0.22
55 0.22
56 0.24
57 0.24
58 0.28
59 0.32
60 0.37
61 0.44
62 0.51