Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8RBA9

Protein Details
Accession A0A3D8RBA9   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
140-166APSETKMKGKKRTVGARKGTKKGRMGNBasic
NLS Segment(s)
PositionSequence
145-164KMKGKKRTVGARKGTKKGRM
Subcellular Location(s) nucl 9.5, cyto_nucl 7.5, mito 5, extr 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSASNVPDASAICIVHPGNSHPQDCDICFQNIFGVFMSAPATTTAPRSESKGSAIRTLQHGHNPKATAQSSVQGQIPTRTFTSLAPRTQPLPLAARIPYPEAARANFRPKIFPGTGVNFDDYPDRHALSSDDEEYLDRFAPSETKMKGKKRTVGARKGTKKGRMGNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.17
5 0.25
6 0.3
7 0.31
8 0.28
9 0.33
10 0.34
11 0.34
12 0.34
13 0.28
14 0.25
15 0.24
16 0.23
17 0.21
18 0.19
19 0.19
20 0.15
21 0.12
22 0.1
23 0.1
24 0.11
25 0.08
26 0.08
27 0.08
28 0.09
29 0.08
30 0.1
31 0.11
32 0.13
33 0.14
34 0.17
35 0.19
36 0.19
37 0.23
38 0.27
39 0.27
40 0.29
41 0.29
42 0.28
43 0.28
44 0.3
45 0.28
46 0.3
47 0.34
48 0.32
49 0.35
50 0.34
51 0.32
52 0.34
53 0.33
54 0.28
55 0.22
56 0.23
57 0.2
58 0.2
59 0.21
60 0.16
61 0.15
62 0.16
63 0.16
64 0.16
65 0.15
66 0.14
67 0.13
68 0.13
69 0.21
70 0.22
71 0.22
72 0.22
73 0.23
74 0.24
75 0.24
76 0.24
77 0.17
78 0.16
79 0.16
80 0.16
81 0.15
82 0.15
83 0.15
84 0.16
85 0.16
86 0.14
87 0.16
88 0.15
89 0.16
90 0.2
91 0.23
92 0.28
93 0.31
94 0.31
95 0.3
96 0.3
97 0.36
98 0.31
99 0.31
100 0.29
101 0.29
102 0.33
103 0.31
104 0.32
105 0.25
106 0.25
107 0.24
108 0.2
109 0.19
110 0.17
111 0.16
112 0.14
113 0.15
114 0.16
115 0.18
116 0.21
117 0.18
118 0.17
119 0.17
120 0.17
121 0.17
122 0.18
123 0.14
124 0.1
125 0.09
126 0.09
127 0.11
128 0.13
129 0.19
130 0.2
131 0.29
132 0.37
133 0.45
134 0.55
135 0.6
136 0.66
137 0.69
138 0.77
139 0.79
140 0.81
141 0.83
142 0.84
143 0.85
144 0.87
145 0.85
146 0.83
147 0.81