Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8QW52

Protein Details
Accession A0A3D8QW52   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-55SRSAKGKSRSRTRSLSRQRKRPKVHEPSTTPTHydrophilic
NLS Segment(s)
PositionSequence
25-46RSAKGKSRSRTRSLSRQRKRPK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
Amino Acid Sequences MSSFAGEDAVVIKSAASSRSSSVSRSAKGKSRSRTRSLSRQRKRPKVHEPSTTPTSSESGSLRLSDEMQDGEQVRQEQRDYENTTLSNADEHYRVTTPPQFQSTGYYEGQSWDQHQQQSFTYSPLPPTPPRLPTPQTRKLPQLSLPPLPPLNLTNYQSFQRQPRVLHCPHLHNHHIHHQLQFKQQNYQYPFQPLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.11
4 0.12
5 0.14
6 0.19
7 0.2
8 0.21
9 0.28
10 0.32
11 0.34
12 0.37
13 0.4
14 0.44
15 0.51
16 0.58
17 0.6
18 0.65
19 0.7
20 0.72
21 0.76
22 0.76
23 0.78
24 0.81
25 0.82
26 0.81
27 0.84
28 0.88
29 0.89
30 0.91
31 0.89
32 0.89
33 0.89
34 0.87
35 0.86
36 0.81
37 0.78
38 0.74
39 0.65
40 0.54
41 0.45
42 0.38
43 0.29
44 0.25
45 0.18
46 0.14
47 0.14
48 0.14
49 0.14
50 0.13
51 0.13
52 0.12
53 0.12
54 0.1
55 0.09
56 0.11
57 0.11
58 0.11
59 0.12
60 0.13
61 0.13
62 0.14
63 0.14
64 0.14
65 0.15
66 0.21
67 0.23
68 0.23
69 0.24
70 0.22
71 0.23
72 0.21
73 0.18
74 0.13
75 0.1
76 0.1
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.12
83 0.15
84 0.16
85 0.18
86 0.2
87 0.19
88 0.19
89 0.23
90 0.23
91 0.22
92 0.2
93 0.19
94 0.17
95 0.17
96 0.18
97 0.15
98 0.14
99 0.14
100 0.17
101 0.19
102 0.2
103 0.2
104 0.2
105 0.23
106 0.22
107 0.19
108 0.18
109 0.16
110 0.18
111 0.19
112 0.22
113 0.2
114 0.26
115 0.29
116 0.31
117 0.33
118 0.38
119 0.4
120 0.45
121 0.53
122 0.55
123 0.58
124 0.57
125 0.61
126 0.58
127 0.58
128 0.53
129 0.53
130 0.49
131 0.46
132 0.44
133 0.41
134 0.38
135 0.35
136 0.32
137 0.24
138 0.24
139 0.26
140 0.27
141 0.27
142 0.28
143 0.3
144 0.32
145 0.35
146 0.35
147 0.38
148 0.4
149 0.4
150 0.45
151 0.52
152 0.51
153 0.57
154 0.56
155 0.54
156 0.55
157 0.6
158 0.58
159 0.54
160 0.56
161 0.56
162 0.59
163 0.54
164 0.55
165 0.54
166 0.55
167 0.6
168 0.62
169 0.55
170 0.56
171 0.57
172 0.6
173 0.59
174 0.59
175 0.53