Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MZ16

Protein Details
Accession B8MZ16    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAPARKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
5-12RKKWSKGK
Subcellular Location(s) mito 14.5, mito_nucl 10.5, cyto 7, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPARKKWSKGKVKDKAQHAVVLEKTVAERLNKDVQSYRLITVATLVDRLKINGSLARKALEDLEEKGQIKKVVGHSKLNIYTRAVTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.82
4 0.74
5 0.67
6 0.57
7 0.52
8 0.42
9 0.36
10 0.29
11 0.21
12 0.19
13 0.16
14 0.17
15 0.12
16 0.13
17 0.16
18 0.23
19 0.23
20 0.25
21 0.26
22 0.26
23 0.28
24 0.29
25 0.25
26 0.19
27 0.18
28 0.16
29 0.14
30 0.13
31 0.09
32 0.09
33 0.08
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.12
41 0.14
42 0.15
43 0.16
44 0.16
45 0.16
46 0.16
47 0.16
48 0.15
49 0.15
50 0.15
51 0.18
52 0.21
53 0.22
54 0.22
55 0.25
56 0.24
57 0.23
58 0.25
59 0.3
60 0.36
61 0.39
62 0.44
63 0.44
64 0.5
65 0.56
66 0.54
67 0.48
68 0.42
69 0.4