Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8QX67

Protein Details
Accession A0A3D8QX67    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
152-178LIVHCKKEGAPQPKKKSKKAGHEGDELBasic
NLS Segment(s)
PositionSequence
161-171APQPKKKSKKA
Subcellular Location(s) nucl 14.5, cyto_nucl 13.333, cyto 11, cyto_mito 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MSADMDIPHANELTKVDSAIQGISSSPPREPKHRRSSSCATGVFNINELEKEGTELEIAKETQKLNWRINKSPTTIEEKEYLKKMLTTPPVKKIDLHFPLGLEVTARNLKGVTIKDACDAIYKQYRKKADDELDNPVLAGFEWDKEESWTRLIVHCKKEGAPQPKKKSKKAGHEGDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.14
5 0.15
6 0.14
7 0.13
8 0.1
9 0.1
10 0.13
11 0.16
12 0.16
13 0.19
14 0.27
15 0.3
16 0.4
17 0.49
18 0.56
19 0.63
20 0.72
21 0.74
22 0.74
23 0.79
24 0.76
25 0.74
26 0.66
27 0.56
28 0.49
29 0.48
30 0.39
31 0.32
32 0.26
33 0.19
34 0.16
35 0.16
36 0.14
37 0.1
38 0.11
39 0.1
40 0.09
41 0.09
42 0.09
43 0.08
44 0.09
45 0.1
46 0.09
47 0.12
48 0.12
49 0.15
50 0.23
51 0.27
52 0.32
53 0.39
54 0.43
55 0.46
56 0.52
57 0.53
58 0.47
59 0.45
60 0.41
61 0.43
62 0.39
63 0.35
64 0.33
65 0.31
66 0.32
67 0.3
68 0.28
69 0.2
70 0.2
71 0.19
72 0.21
73 0.26
74 0.3
75 0.31
76 0.38
77 0.42
78 0.41
79 0.41
80 0.38
81 0.4
82 0.36
83 0.36
84 0.28
85 0.25
86 0.25
87 0.23
88 0.21
89 0.11
90 0.08
91 0.08
92 0.09
93 0.09
94 0.09
95 0.08
96 0.09
97 0.13
98 0.14
99 0.16
100 0.16
101 0.17
102 0.18
103 0.18
104 0.18
105 0.17
106 0.17
107 0.17
108 0.24
109 0.27
110 0.31
111 0.37
112 0.43
113 0.42
114 0.45
115 0.49
116 0.47
117 0.53
118 0.51
119 0.52
120 0.48
121 0.45
122 0.42
123 0.32
124 0.26
125 0.16
126 0.15
127 0.08
128 0.07
129 0.1
130 0.1
131 0.11
132 0.14
133 0.18
134 0.17
135 0.18
136 0.2
137 0.19
138 0.23
139 0.32
140 0.37
141 0.39
142 0.42
143 0.43
144 0.43
145 0.5
146 0.55
147 0.56
148 0.59
149 0.65
150 0.72
151 0.79
152 0.86
153 0.86
154 0.88
155 0.86
156 0.87
157 0.87
158 0.86