Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8QCW9

Protein Details
Accession A0A3D8QCW9   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
125-150VVQTREERTRERRRRERRRSDAGVGGBasic
NLS Segment(s)
PositionSequence
132-170RTRERRRRERRRSDAGVGGVKARRAWRKGMGKARARGPD
Subcellular Location(s) mito 15, nucl 5.5, cyto_nucl 5.333, cyto 4, cyto_pero 3.333
Family & Domain DBs
Amino Acid Sequences MAQSPTDIQSLKVLQTSTSTSTSISSSFHKMPVSKNTRLGRSRRGPGNRTPLYYLATPLRVPRANRLYQRLPSPAVTDDDEDDDISEMSVDLGPPAMGVWGNPSHVEDRTGGWVNYWSAEEYGEVVQTREERTRERRRRERRRSDAGVGGVKARRAWRKGMGKARARGPDGRFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.23
4 0.22
5 0.22
6 0.21
7 0.18
8 0.19
9 0.2
10 0.18
11 0.16
12 0.16
13 0.2
14 0.21
15 0.23
16 0.25
17 0.26
18 0.31
19 0.4
20 0.44
21 0.43
22 0.5
23 0.53
24 0.58
25 0.63
26 0.63
27 0.62
28 0.63
29 0.66
30 0.67
31 0.7
32 0.66
33 0.67
34 0.72
35 0.65
36 0.6
37 0.55
38 0.47
39 0.42
40 0.38
41 0.32
42 0.24
43 0.22
44 0.2
45 0.18
46 0.23
47 0.23
48 0.24
49 0.3
50 0.35
51 0.39
52 0.43
53 0.48
54 0.48
55 0.47
56 0.5
57 0.44
58 0.39
59 0.33
60 0.31
61 0.26
62 0.22
63 0.2
64 0.17
65 0.15
66 0.14
67 0.13
68 0.11
69 0.1
70 0.08
71 0.07
72 0.06
73 0.05
74 0.03
75 0.03
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.06
87 0.06
88 0.07
89 0.07
90 0.09
91 0.1
92 0.11
93 0.12
94 0.1
95 0.11
96 0.15
97 0.17
98 0.15
99 0.14
100 0.16
101 0.15
102 0.15
103 0.14
104 0.1
105 0.09
106 0.09
107 0.09
108 0.08
109 0.08
110 0.09
111 0.08
112 0.08
113 0.09
114 0.1
115 0.13
116 0.16
117 0.18
118 0.24
119 0.33
120 0.45
121 0.54
122 0.63
123 0.71
124 0.78
125 0.88
126 0.92
127 0.94
128 0.92
129 0.92
130 0.89
131 0.84
132 0.78
133 0.73
134 0.66
135 0.55
136 0.5
137 0.42
138 0.36
139 0.34
140 0.35
141 0.37
142 0.36
143 0.41
144 0.46
145 0.54
146 0.62
147 0.69
148 0.71
149 0.72
150 0.76
151 0.78
152 0.76
153 0.7
154 0.68