Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3D8QFL5

Protein Details
Accession A0A3D8QFL5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-58QPEPKTDSMTRKRRKNTKVRTGCLTCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
Amino Acid Sequences MAQERFPSRSALGLTSLSLQGAAELRSVGTIVQPEPKTDSMTRKRRKNTKVRTGCLTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.12
5 0.11
6 0.09
7 0.07
8 0.08
9 0.07
10 0.06
11 0.06
12 0.05
13 0.05
14 0.06
15 0.05
16 0.04
17 0.05
18 0.05
19 0.12
20 0.13
21 0.14
22 0.17
23 0.18
24 0.22
25 0.24
26 0.34
27 0.37
28 0.48
29 0.57
30 0.62
31 0.71
32 0.78
33 0.85
34 0.86
35 0.87
36 0.88
37 0.89
38 0.86