Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8N3U4

Protein Details
Accession B8N3U4    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
206-229YIKGSSEKAKREKARKEKNILEVDHydrophilic
NLS Segment(s)
PositionSequence
30-54KAIDKPAPRVGKRDAPKEAPSQPRA
81-100REKPTDEREGGARRGGRPRG
212-223EKAKREKARKEK
236-263PRGNSGPRGRGGRGGRGARGGRGNGPRS
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039764  HABP4/SERBP1  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF09598  Stm1_N  
Amino Acid Sequences MADVRSKNLYELLGNDPELDPSRPPAPPTKAIDKPAPRVGKRDAPKEAPSQPRAGQNSRRGNFSGNEAAFRDRNAGRNQNREKPTDEREGGARRGGRPRGDRQSRTGQTDTGKKVNQGWGGQSGEKELDDERAGEKIAQADENEPQTPAEEAEPAEKAKSYNDYLAEKAAAGDFSAKPVRAANEGTKADSKWANAKEFKREEDENYIKGSSEKAKREKARKEKNILEVDMRFVEAPRGNSGPRGRGGRGGRGARGGRGNGPRSERTERTAPVTVDEKNFPSLGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.23
5 0.25
6 0.23
7 0.19
8 0.2
9 0.24
10 0.24
11 0.27
12 0.33
13 0.37
14 0.43
15 0.48
16 0.53
17 0.55
18 0.59
19 0.65
20 0.63
21 0.63
22 0.64
23 0.67
24 0.59
25 0.59
26 0.6
27 0.6
28 0.61
29 0.62
30 0.6
31 0.57
32 0.6
33 0.61
34 0.64
35 0.63
36 0.59
37 0.56
38 0.52
39 0.55
40 0.56
41 0.57
42 0.57
43 0.58
44 0.65
45 0.62
46 0.62
47 0.55
48 0.52
49 0.45
50 0.42
51 0.41
52 0.3
53 0.31
54 0.29
55 0.31
56 0.28
57 0.27
58 0.27
59 0.2
60 0.25
61 0.3
62 0.38
63 0.41
64 0.51
65 0.58
66 0.62
67 0.64
68 0.61
69 0.59
70 0.55
71 0.55
72 0.54
73 0.47
74 0.39
75 0.41
76 0.43
77 0.4
78 0.38
79 0.34
80 0.29
81 0.36
82 0.39
83 0.39
84 0.4
85 0.47
86 0.54
87 0.6
88 0.59
89 0.58
90 0.64
91 0.62
92 0.62
93 0.54
94 0.47
95 0.42
96 0.46
97 0.44
98 0.39
99 0.36
100 0.31
101 0.33
102 0.35
103 0.34
104 0.28
105 0.25
106 0.24
107 0.24
108 0.24
109 0.21
110 0.17
111 0.14
112 0.13
113 0.12
114 0.08
115 0.09
116 0.08
117 0.09
118 0.08
119 0.08
120 0.09
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.09
128 0.1
129 0.12
130 0.12
131 0.1
132 0.1
133 0.09
134 0.09
135 0.09
136 0.07
137 0.06
138 0.06
139 0.08
140 0.09
141 0.08
142 0.08
143 0.08
144 0.08
145 0.09
146 0.12
147 0.12
148 0.14
149 0.16
150 0.18
151 0.18
152 0.18
153 0.17
154 0.13
155 0.12
156 0.1
157 0.07
158 0.06
159 0.08
160 0.07
161 0.1
162 0.12
163 0.12
164 0.12
165 0.13
166 0.15
167 0.14
168 0.17
169 0.17
170 0.23
171 0.24
172 0.26
173 0.26
174 0.25
175 0.25
176 0.24
177 0.23
178 0.22
179 0.26
180 0.29
181 0.34
182 0.37
183 0.44
184 0.45
185 0.46
186 0.45
187 0.43
188 0.41
189 0.44
190 0.45
191 0.37
192 0.36
193 0.33
194 0.28
195 0.26
196 0.25
197 0.23
198 0.27
199 0.34
200 0.39
201 0.49
202 0.57
203 0.67
204 0.75
205 0.78
206 0.81
207 0.83
208 0.84
209 0.82
210 0.83
211 0.8
212 0.71
213 0.66
214 0.55
215 0.49
216 0.4
217 0.34
218 0.25
219 0.18
220 0.21
221 0.19
222 0.2
223 0.21
224 0.23
225 0.22
226 0.29
227 0.33
228 0.32
229 0.34
230 0.37
231 0.34
232 0.4
233 0.43
234 0.45
235 0.5
236 0.49
237 0.46
238 0.49
239 0.49
240 0.45
241 0.47
242 0.4
243 0.39
244 0.44
245 0.47
246 0.45
247 0.5
248 0.5
249 0.52
250 0.58
251 0.53
252 0.51
253 0.54
254 0.5
255 0.51
256 0.53
257 0.46
258 0.42
259 0.43
260 0.41
261 0.38
262 0.39
263 0.35
264 0.32
265 0.31