Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8QWD8

Protein Details
Accession A0A3D8QWD8   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKTTKRATKGRAEKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
5-27KTTKRATKGRAEKKKKDPNAPKR
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTKRATKGRAEKKKKDPNAPKRGLSAYMFFANEQRENVREENPGISFGQVGKVLGERWKALNEKQRSPYEAKAAQDKKRYEDEKANYNASTLSFPEHSSQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.87
4 0.88
5 0.92
6 0.89
7 0.9
8 0.9
9 0.9
10 0.9
11 0.87
12 0.78
13 0.72
14 0.66
15 0.58
16 0.49
17 0.4
18 0.32
19 0.27
20 0.25
21 0.21
22 0.21
23 0.2
24 0.19
25 0.18
26 0.16
27 0.15
28 0.18
29 0.19
30 0.19
31 0.17
32 0.17
33 0.18
34 0.16
35 0.17
36 0.13
37 0.12
38 0.1
39 0.09
40 0.09
41 0.08
42 0.07
43 0.06
44 0.06
45 0.07
46 0.09
47 0.11
48 0.1
49 0.11
50 0.15
51 0.17
52 0.21
53 0.3
54 0.33
55 0.38
56 0.44
57 0.46
58 0.47
59 0.5
60 0.48
61 0.46
62 0.45
63 0.4
64 0.43
65 0.47
66 0.5
67 0.54
68 0.53
69 0.5
70 0.55
71 0.56
72 0.52
73 0.54
74 0.52
75 0.53
76 0.56
77 0.54
78 0.45
79 0.43
80 0.38
81 0.29
82 0.26
83 0.18
84 0.18
85 0.16
86 0.17