Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3D8S162

Protein Details
Accession A0A3D8S162   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSLPKPKLPREPKSSRVPKMTKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MSLPKPKLPREPKSSRVPKMTKPALIEPWSMYPALHDSVRRLLKEDDLSFTFFATDDDETFIEDYDTNIMGRFRCLNKACPKAVWTSKAIAITIRMYPEQKYNARVYHQRCKGCGCLSRPTPDDSYAERIAYRLKLWGGIEMDKPSYTDRANRRPHVSALCEGCKHGHCKFMYGTAPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.81
4 0.78
5 0.76
6 0.77
7 0.76
8 0.69
9 0.64
10 0.63
11 0.6
12 0.56
13 0.5
14 0.42
15 0.38
16 0.35
17 0.3
18 0.24
19 0.18
20 0.17
21 0.18
22 0.18
23 0.16
24 0.17
25 0.25
26 0.3
27 0.28
28 0.29
29 0.28
30 0.31
31 0.35
32 0.34
33 0.3
34 0.28
35 0.29
36 0.26
37 0.24
38 0.2
39 0.14
40 0.13
41 0.1
42 0.09
43 0.08
44 0.09
45 0.09
46 0.1
47 0.1
48 0.09
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.07
56 0.08
57 0.08
58 0.09
59 0.13
60 0.13
61 0.2
62 0.22
63 0.29
64 0.36
65 0.42
66 0.42
67 0.39
68 0.39
69 0.38
70 0.4
71 0.35
72 0.28
73 0.24
74 0.25
75 0.24
76 0.23
77 0.17
78 0.14
79 0.13
80 0.12
81 0.11
82 0.1
83 0.11
84 0.12
85 0.15
86 0.19
87 0.2
88 0.23
89 0.25
90 0.26
91 0.29
92 0.36
93 0.39
94 0.43
95 0.49
96 0.47
97 0.45
98 0.47
99 0.47
100 0.45
101 0.45
102 0.39
103 0.4
104 0.41
105 0.45
106 0.43
107 0.43
108 0.39
109 0.35
110 0.34
111 0.29
112 0.32
113 0.27
114 0.26
115 0.22
116 0.21
117 0.22
118 0.2
119 0.18
120 0.15
121 0.14
122 0.16
123 0.16
124 0.2
125 0.2
126 0.21
127 0.23
128 0.22
129 0.23
130 0.2
131 0.21
132 0.18
133 0.19
134 0.19
135 0.25
136 0.32
137 0.4
138 0.5
139 0.55
140 0.6
141 0.6
142 0.63
143 0.62
144 0.57
145 0.54
146 0.51
147 0.5
148 0.45
149 0.43
150 0.41
151 0.39
152 0.4
153 0.36
154 0.37
155 0.32
156 0.35
157 0.36
158 0.39
159 0.38